From 23f6c8aa4a2301b76cbe7dffc2b91046c0271d7c Mon Sep 17 00:00:00 2001 From: ucwong Date: Wed, 25 Jun 2025 18:14:32 +0800 Subject: [PATCH 1/2] open trie when first invoke --- core/state/database.go | 10 ++++++++++ core/state/iterator.go | 20 ++++++++++++++++---- core/state/statedb.go | 33 ++++++++++++++++++++++++++------- 3 files changed, 52 insertions(+), 11 deletions(-) diff --git a/core/state/database.go b/core/state/database.go index 77b394ab7e..03c1221e9e 100644 --- a/core/state/database.go +++ b/core/state/database.go @@ -248,3 +248,13 @@ func (db *CachingDB) Snapshot() *snapshot.Tree { func (db *CachingDB) SetSnapshot(snap *snapshot.Tree) { db.snap = snap } + +// mustCopyTrie returns a deep-copied trie. +func mustCopyTrie(t Trie) Trie { + switch t := t.(type) { + case *trie.StateTrie: + return t.Copy() + default: + panic(fmt.Errorf("unknown trie type %T", t)) + } +} diff --git a/core/state/iterator.go b/core/state/iterator.go index aba6e57b3a..66430e22bc 100644 --- a/core/state/iterator.go +++ b/core/state/iterator.go @@ -32,6 +32,8 @@ import ( type NodeIterator struct { state *StateDB // State being iterated + tr Trie // Primary account trie for traversal + stateIt trie.NodeIterator // Primary iterator for the global state trie dataIt trie.NodeIterator // Secondary iterator for the data trie of a contract @@ -74,9 +76,20 @@ func (it *NodeIterator) step() error { if it.state == nil { return nil } + if it.tr == nil { + tr, err := it.state.db.OpenTrie(it.state.originalRoot) + if err != nil { + return err + } + it.tr = tr + } // Initialize the iterator if we've just started if it.stateIt == nil { - it.stateIt = it.state.trie.NodeIterator(nil) + stateIt := it.tr.NodeIterator(nil) + if stateIt == nil { + return errors.New("state iter is nil") + } + it.stateIt = stateIt } // If we had data nodes previously, we surely have at least state nodes if it.dataIt != nil { @@ -111,15 +124,14 @@ func (it *NodeIterator) step() error { return err } // Lookup the preimage of account hash - preimage := it.state.trie.GetKey(it.stateIt.LeafKey()) + preimage := it.tr.GetKey(it.stateIt.LeafKey()) if preimage == nil { return errors.New("account address is not available") } address := common.BytesToAddress(preimage) // Traverse the storage slots belong to the account - dataTrie, err := it.state.db.OpenStorageTrie(it.state.originalRoot, address, account.Root, it.state.trie) - //dataTrie, err := it.state.db.OpenStorageTrie(common.BytesToAddress(it.stateIt.LeafKey()), account.Root) + dataTrie, err := it.state.db.OpenStorageTrie(it.state.originalRoot, address, account.Root, it.tr) if err != nil { return err } diff --git a/core/state/statedb.go b/core/state/statedb.go index 9db798e9da..bc604a8612 100644 --- a/core/state/statedb.go +++ b/core/state/statedb.go @@ -166,13 +166,8 @@ type StateDB struct { // Create a new state from a given trie. func New(root common.Hash, db Database) (*StateDB, error) { - tr, err := db.OpenTrie(root) - if err != nil { - return nil, err - } sdb := &StateDB{ db: db, - trie: tr, originalRoot: root, accounts: make(map[common.Hash][]byte), storages: make(map[common.Hash]map[common.Hash][]byte), @@ -671,6 +666,14 @@ func (s *StateDB) getStateObject(addr common.Address) *stateObject { // If snapshot unavailable or reading from it failed, load from the database if data == nil { start := time.Now() + if s.trie == nil { + tr, err := s.db.OpenTrie(s.originalRoot) + if err != nil { + return nil + } + s.trie = tr + + } enc, err := s.trie.TryGet(addr.Bytes()) s.AccountReads += time.Since(start) if err != nil { @@ -782,8 +785,7 @@ func (db *StateDB) ForEachStorage(addr common.Address, cb func(key, value common func (s *StateDB) Copy() *StateDB { // Copy all the basic fields, initialize the memory ones state := &StateDB{ - db: s.db, - trie: s.db.CopyTrie(s.trie), + db: s.db, //hasher: crypto.NewKeccakState(), originalRoot: s.originalRoot, accounts: copySet(s.accounts), @@ -808,6 +810,9 @@ func (s *StateDB) Copy() *StateDB { // miner to operate trie-backed only. snap: s.snap, } + if s.trie != nil { + state.trie = mustCopyTrie(s.trie) + } // Deep copy cached state objects. for addr, obj := range s.stateObjects { state.stateObjects[addr] = obj.deepCopy(state) @@ -913,6 +918,20 @@ func (s *StateDB) Finalise(deleteEmptyObjects bool) { func (s *StateDB) IntermediateRoot(deleteEmptyObjects bool) common.Hash { // Finalise all the dirty storage states and write them into the tries s.Finalise(deleteEmptyObjects) + // Initialize the trie if it's not constructed yet. If the prefetch + // is enabled, the trie constructed below will be replaced by the + // prefetched one. + // + // This operation must be done before state object storage hashing, + // as it assumes the main trie is already loaded. + if s.trie == nil { + tr, err := s.db.OpenTrie(s.originalRoot) + if err != nil { + s.setError(err) + return common.Hash{} + } + s.trie = tr + } // If there was a trie prefetcher operating, terminate it async so that the // individual storage tries can be updated as soon as the disk load finishes. From 1cbc540c555f7021cd74b4e88627775f57620e16 Mon Sep 17 00:00:00 2001 From: ucwong Date: Wed, 25 Jun 2025 19:50:02 +0800 Subject: [PATCH 2/2] deps --- go.mod | 12 +- go.sum | 24 +- .../github.com/dop251/goja/compiler_expr.go | 2 +- .../github.com/klauspost/cpuid/v2/README.md | 3 + vendor/github.com/klauspost/cpuid/v2/cpuid.go | 15 +- .../klauspost/cpuid/v2/featureid_string.go | 437 +- .../klauspost/cpuid/v2/os_darwin_arm64.go | 80 +- .../go.opentelemetry.io/otel/.clomonitor.yml | 3 + vendor/go.opentelemetry.io/otel/.golangci.yml | 6 +- vendor/go.opentelemetry.io/otel/CHANGELOG.md | 60 +- .../go.opentelemetry.io/otel/CONTRIBUTING.md | 17 +- vendor/go.opentelemetry.io/otel/Makefile | 2 +- vendor/go.opentelemetry.io/otel/README.md | 1 + vendor/go.opentelemetry.io/otel/RELEASING.md | 23 + .../otel/dependencies.Dockerfile | 4 +- .../otel/semconv/v1.34.0/MIGRATION.md | 4 + .../otel/semconv/v1.34.0/README.md | 3 + .../otel/semconv/v1.34.0/attribute_group.go | 13851 ++++++++++++++++ .../otel/semconv/v1.34.0/doc.go | 9 + .../otel/semconv/v1.34.0/exception.go | 9 + .../otel/semconv/v1.34.0/schema.go | 9 + vendor/go.opentelemetry.io/otel/trace/auto.go | 2 +- vendor/go.opentelemetry.io/otel/version.go | 2 +- vendor/go.opentelemetry.io/otel/versions.yaml | 11 +- vendor/modernc.org/libc/asm_linux_amd64.go | 1316 ++ vendor/modernc.org/libc/asm_linux_amd64.s | 2633 +++ vendor/modernc.org/libc/tls_linux_amd64.go | 2 + vendor/modernc.org/libc/tls_linux_amd64.s | 7 +- vendor/modules.txt | 13 +- 29 files changed, 18252 insertions(+), 308 deletions(-) create mode 100644 vendor/go.opentelemetry.io/otel/.clomonitor.yml create mode 100644 vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md create mode 100644 vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md create mode 100644 vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go create mode 100644 vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go create mode 100644 vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go create mode 100644 vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go diff --git a/go.mod b/go.mod index b0e46ace7a..c9cd534a9a 100644 --- a/go.mod +++ b/go.mod @@ -22,7 +22,7 @@ require ( github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc github.com/deckarep/golang-set/v2 v2.8.0 github.com/decred/dcrd/dcrec/secp256k1/v4 v4.4.0 - github.com/dop251/goja v0.0.0-20250531102226-cb187b08699c + github.com/dop251/goja v0.0.0-20250624190929-4d26883d182a github.com/ethereum/c-kzg-4844 v1.0.3 github.com/ethereum/go-ethereum v1.15.11 github.com/ethereum/go-verkle v0.2.2 @@ -168,7 +168,7 @@ require ( github.com/influxdata/line-protocol v0.0.0-20210922203350-b1ad95c89adf // indirect github.com/jedib0t/go-pretty/v6 v6.6.7 // indirect github.com/klauspost/compress v1.18.0 // indirect - github.com/klauspost/cpuid/v2 v2.2.10 // indirect + github.com/klauspost/cpuid/v2 v2.2.11 // indirect github.com/kr/pretty v0.3.1 // indirect github.com/kr/text v0.2.0 // indirect github.com/mattn/go-localereader v0.0.1 // indirect @@ -241,9 +241,9 @@ require ( github.com/zeebo/xxh3 v1.0.3-0.20230502181907-3808c706a06a // indirect go.etcd.io/bbolt v1.4.1 // indirect go.opentelemetry.io/auto/sdk v1.1.0 // indirect - go.opentelemetry.io/otel v1.36.0 // indirect - go.opentelemetry.io/otel/metric v1.36.0 // indirect - go.opentelemetry.io/otel/trace v1.36.0 // indirect + go.opentelemetry.io/otel v1.37.0 // indirect + go.opentelemetry.io/otel/metric v1.37.0 // indirect + go.opentelemetry.io/otel/trace v1.37.0 // indirect golang.org/x/exp v0.0.0-20250620022241-b7579e27df2b // indirect golang.org/x/mod v0.25.0 // indirect golang.org/x/net v0.41.0 // indirect @@ -251,7 +251,7 @@ require ( gopkg.in/yaml.v2 v2.4.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect lukechampine.com/blake3 v1.4.1 // indirect - modernc.org/libc v1.66.0 // indirect + modernc.org/libc v1.66.1 // indirect modernc.org/mathutil v1.7.1 // indirect modernc.org/memory v1.11.0 // indirect modernc.org/sqlite v1.38.0 // indirect diff --git a/go.sum b/go.sum index 406f51d9d8..2571900158 100644 --- a/go.sum +++ b/go.sum @@ -424,8 +424,8 @@ github.com/dlclark/regexp2 v1.11.5/go.mod h1:DHkYz0B9wPfa6wondMfaivmHpzrQ3v9q8cn github.com/docker/docker v1.13.1/go.mod h1:eEKB0N0r5NX/I1kEveEz05bcu8tLC/8azJZsviup8Sk= github.com/docopt/docopt-go v0.0.0-20180111231733-ee0de3bc6815/go.mod h1:WwZ+bS3ebgob9U8Nd0kOddGdZWjyMGR8Wziv+TBNwSE= github.com/dop251/goja v0.0.0-20200721192441-a695b0cdd498/go.mod h1:Mw6PkjjMXWbTj+nnj4s3QPXq1jaT0s5pC0iFD4+BOAA= -github.com/dop251/goja v0.0.0-20250531102226-cb187b08699c h1:In87uFQZsuGfjDDNfWnzMVY6JVTwc8XYMl6W2DAmNjk= -github.com/dop251/goja v0.0.0-20250531102226-cb187b08699c/go.mod h1:MxLav0peU43GgvwVgNbLAj1s/bSGboKkhuULvq/7hx4= +github.com/dop251/goja v0.0.0-20250624190929-4d26883d182a h1:QIWJoaD2+zxUjN28l8zixmbuvtYqqcxj49Iwzw7mDpk= +github.com/dop251/goja v0.0.0-20250624190929-4d26883d182a/go.mod h1:MxLav0peU43GgvwVgNbLAj1s/bSGboKkhuULvq/7hx4= github.com/dustin/go-humanize v0.0.0-20171111073723-bb3d318650d4/go.mod h1:HtrtbFcZ19U5GC7JDqmcUSB87Iq5E25KnS6fMYU6eOk= github.com/dustin/go-humanize v0.0.0-20180421182945-02af3965c54e/go.mod h1:HtrtbFcZ19U5GC7JDqmcUSB87Iq5E25KnS6fMYU6eOk= github.com/dustin/go-humanize v1.0.0/go.mod h1:HtrtbFcZ19U5GC7JDqmcUSB87Iq5E25KnS6fMYU6eOk= @@ -757,8 +757,8 @@ github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zt github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ= github.com/klauspost/cpuid v0.0.0-20170728055534-ae7887de9fa5/go.mod h1:Pj4uuM528wm8OyEC2QMXAi2YiTZ96dNQPGgoMS4s3ek= github.com/klauspost/cpuid v1.2.3/go.mod h1:Pj4uuM528wm8OyEC2QMXAi2YiTZ96dNQPGgoMS4s3ek= -github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE= -github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= +github.com/klauspost/cpuid/v2 v2.2.11 h1:0OwqZRYI2rFrjS4kvkDnqJkKHdHaRnCm68/DY4OxRzU= +github.com/klauspost/cpuid/v2 v2.2.11/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= github.com/klauspost/crc32 v0.0.0-20161016154125-cb6bfca970f6/go.mod h1:+ZoRqAPRLkC4NPOvfYeR5KNOrY6TD+/sAC3HXPZgDYg= github.com/klauspost/pgzip v1.0.2-0.20170402124221-0bf5dcad4ada/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs= github.com/klauspost/reedsolomon v1.9.3/go.mod h1:CwCi+NUr9pqSVktrkN+Ondf06rkhYZ/pcNv7fu+8Un4= @@ -1305,12 +1305,12 @@ go.opencensus.io v0.22.2/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw= go.opencensus.io v0.22.3/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw= go.opentelemetry.io/auto/sdk v1.1.0 h1:cH53jehLUN6UFLY71z+NDOiNJqDdPRaXzTel0sJySYA= go.opentelemetry.io/auto/sdk v1.1.0/go.mod h1:3wSPjt5PWp2RhlCcmmOial7AvC4DQqZb7a7wCow3W8A= -go.opentelemetry.io/otel v1.36.0 h1:UumtzIklRBY6cI/lllNZlALOF5nNIzJVb16APdvgTXg= -go.opentelemetry.io/otel v1.36.0/go.mod h1:/TcFMXYjyRNh8khOAO9ybYkqaDBb/70aVwkNML4pP8E= -go.opentelemetry.io/otel/metric v1.36.0 h1:MoWPKVhQvJ+eeXWHFBOPoBOi20jh6Iq2CcCREuTYufE= -go.opentelemetry.io/otel/metric v1.36.0/go.mod h1:zC7Ks+yeyJt4xig9DEw9kuUFe5C3zLbVjV2PzT6qzbs= -go.opentelemetry.io/otel/trace v1.36.0 h1:ahxWNuqZjpdiFAyrIoQ4GIiAIhxAunQR6MUoKrsNd4w= -go.opentelemetry.io/otel/trace v1.36.0/go.mod h1:gQ+OnDZzrybY4k4seLzPAWNwVBBVlF2szhehOBB/tGA= +go.opentelemetry.io/otel v1.37.0 h1:9zhNfelUvx0KBfu/gb+ZgeAfAgtWrfHJZcAqFC228wQ= +go.opentelemetry.io/otel v1.37.0/go.mod h1:ehE/umFRLnuLa/vSccNq9oS1ErUlkkK71gMcN34UG8I= +go.opentelemetry.io/otel/metric v1.37.0 h1:mvwbQS5m0tbmqML4NqK+e3aDiO02vsf/WgbsdpcPoZE= +go.opentelemetry.io/otel/metric v1.37.0/go.mod h1:04wGrZurHYKOc+RKeye86GwKiTb9FKm1WHtO+4EVr2E= +go.opentelemetry.io/otel/trace v1.37.0 h1:HLdcFNbRQBE2imdSEgm/kwqmQj1Or1l/7bW6mxVK7z4= +go.opentelemetry.io/otel/trace v1.37.0/go.mod h1:TlgrlQ+PtQO5XFerSPUYG0JSgGyryXewPGyayAWSBS0= go.uber.org/atomic v1.3.2/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE= go.uber.org/atomic v1.4.0/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE= go.uber.org/atomic v1.5.0/go.mod h1:sABNBOSYdrvTF6hTgEIbc7YasKWGhgEQZyfxyTvoXHQ= @@ -1770,8 +1770,8 @@ modernc.org/gc/v2 v2.6.5 h1:nyqdV8q46KvTpZlsw66kWqwXRHdjIlJOhG6kxiV/9xI= modernc.org/gc/v2 v2.6.5/go.mod h1:YgIahr1ypgfe7chRuJi2gD7DBQiKSLMPgBQe9oIiito= modernc.org/goabi0 v0.0.3 h1:y81b9r3asCh6Xtse6Nz85aYGB0cG3M3U6222yap1KWI= modernc.org/goabi0 v0.0.3/go.mod h1:CEFRnnJhKvWT1c1JTI3Avm+tgOWbkOu5oPA8eH8LnMI= -modernc.org/libc v1.66.0 h1:eoFuDb1ozurUY5WSWlgvxHp0FuL+AncMwNjFqGYMJPQ= -modernc.org/libc v1.66.0/go.mod h1:AiZxInURfEJx516LqEaFcrC+X38rt9G7+8ojIXQKHbo= +modernc.org/libc v1.66.1 h1:4uQsntXbVyAgrV+j6NhKvDiUypoJL48BWQx6sy9y8ok= +modernc.org/libc v1.66.1/go.mod h1:AiZxInURfEJx516LqEaFcrC+X38rt9G7+8ojIXQKHbo= modernc.org/mathutil v1.7.1 h1:GCZVGXdaN8gTqB1Mf/usp1Y/hSqgI2vAGGP4jZMCxOU= modernc.org/mathutil v1.7.1/go.mod h1:4p5IwJITfppl0G4sUEDtCr4DthTaT47/N3aT6MhfgJg= modernc.org/memory v1.11.0 h1:o4QC8aMQzmcwCK3t3Ux/ZHmwFPzE6hf2Y5LbkRs+hbI= diff --git a/vendor/github.com/dop251/goja/compiler_expr.go b/vendor/github.com/dop251/goja/compiler_expr.go index 71fdad3812..3f537415d3 100644 --- a/vendor/github.com/dop251/goja/compiler_expr.go +++ b/vendor/github.com/dop251/goja/compiler_expr.go @@ -1701,7 +1701,7 @@ func (e *compiledFunctionLiteral) compile() (prg *Program, name unistring.String stashSize, stackSize := s.finaliseVarAlloc(0) - if needInitThis && (s.numArgs > 0 && !s.argsInStash || stackSize > 0) { + if needInitThis && (!s.argsInStash || firstForwardRef != -1 || stackSize > 0) { code[preambleLen-delta] = initStashP(code[preambleLen-delta].(initStash)) delta++ code[preambleLen-delta] = loadStack(0) diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index e59d3d0c08..7b1d599211 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -285,6 +285,7 @@ Exit Code 1 | AMXCOMPLEX | Tile computational operations on complex numbers | | AMXTILE | Tile architecture | | AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile | +| AMXTRANSPOSE | Tile multiply where the first operand is transposed | | APX_F | Intel APX | | AVX | AVX functions | | AVX10 | If set the Intel AVX10 Converged Vector ISA is supported | @@ -420,6 +421,8 @@ Exit Code 1 | SHA | Intel SHA Extensions | | SME | AMD Secure Memory Encryption supported | | SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | +| SM3_X86 | SM3 instructions | +| SM4_X86 | SM4 instructions | | SPEC_CTRL_SSBD | Speculative Store Bypass Disable | | SRBDS_CTRL | SRBDS mitigation MSR available | | SSE | SSE functions | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 8103fb3435..248439a9a5 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -85,6 +85,7 @@ const ( AMXTILE // Tile architecture AMXTF32 // Tile architecture AMXCOMPLEX // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile + AMXTRANSPOSE // Tile multiply where the first operand is transposed APX_F // Intel APX AVX // AVX functions AVX10 // If set the Intel AVX10 Converged Vector ISA is supported @@ -222,6 +223,8 @@ const ( SHA // Intel SHA Extensions SME // AMD Secure Memory Encryption supported SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SM3_X86 // SM3 instructions + SM4_X86 // SM4 instructions SPEC_CTRL_SSBD // Speculative Store Bypass Disable SRBDS_CTRL // SRBDS mitigation MSR available SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO. @@ -283,7 +286,7 @@ const ( CRC32 // CRC32/CRC32C instructions DCPOP // Data cache clean to Point of Persistence (DC CVAP) EVTSTRM // Generic timer - FCMA // Floatin point complex number addition and multiplication + FCMA // Floating point complex number addition and multiplication FHM // FMLAL and FMLSL instructions FP // Single-precision and double-precision floating point FPHP // Half-precision floating point @@ -878,7 +881,12 @@ func physicalCores() int { v, _ := vendorID() switch v { case Intel: - return logicalCores() / threadsPerCore() + lc := logicalCores() + tpc := threadsPerCore() + if lc > 0 && tpc > 0 { + return lc / tpc + } + return 0 case AMD, Hygon: lc := logicalCores() tpc := threadsPerCore() @@ -1279,6 +1287,8 @@ func support() flagSet { // CPUID.(EAX=7, ECX=1).EAX eax1, _, _, edx1 := cpuidex(7, 1) fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<1) != 0, SM3_X86) + fs.setIf(eax1&(1<<2) != 0, SM4_X86) fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) @@ -1290,6 +1300,7 @@ func support() flagSet { // CPUID.(EAX=7, ECX=1).EDX fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<6) != 0, AMXTRANSPOSE) fs.setIf(edx1&(1<<7) != 0, AMXTF32) fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX) fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16) diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 04760c1af3..07704351fa 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -19,227 +19,230 @@ func _() { _ = x[AMXTILE-9] _ = x[AMXTF32-10] _ = x[AMXCOMPLEX-11] - _ = x[APX_F-12] - _ = x[AVX-13] - _ = x[AVX10-14] - _ = x[AVX10_128-15] - _ = x[AVX10_256-16] - _ = x[AVX10_512-17] - _ = x[AVX2-18] - _ = x[AVX512BF16-19] - _ = x[AVX512BITALG-20] - _ = x[AVX512BW-21] - _ = x[AVX512CD-22] - _ = x[AVX512DQ-23] - _ = x[AVX512ER-24] - _ = x[AVX512F-25] - _ = x[AVX512FP16-26] - _ = x[AVX512IFMA-27] - _ = x[AVX512PF-28] - _ = x[AVX512VBMI-29] - _ = x[AVX512VBMI2-30] - _ = x[AVX512VL-31] - _ = x[AVX512VNNI-32] - _ = x[AVX512VP2INTERSECT-33] - _ = x[AVX512VPOPCNTDQ-34] - _ = x[AVXIFMA-35] - _ = x[AVXNECONVERT-36] - _ = x[AVXSLOW-37] - _ = x[AVXVNNI-38] - _ = x[AVXVNNIINT8-39] - _ = x[AVXVNNIINT16-40] - _ = x[BHI_CTRL-41] - _ = x[BMI1-42] - _ = x[BMI2-43] - _ = x[CETIBT-44] - _ = x[CETSS-45] - _ = x[CLDEMOTE-46] - _ = x[CLMUL-47] - _ = x[CLZERO-48] - _ = x[CMOV-49] - _ = x[CMPCCXADD-50] - _ = x[CMPSB_SCADBS_SHORT-51] - _ = x[CMPXCHG8-52] - _ = x[CPBOOST-53] - _ = x[CPPC-54] - _ = x[CX16-55] - _ = x[EFER_LMSLE_UNS-56] - _ = x[ENQCMD-57] - _ = x[ERMS-58] - _ = x[F16C-59] - _ = x[FLUSH_L1D-60] - _ = x[FMA3-61] - _ = x[FMA4-62] - _ = x[FP128-63] - _ = x[FP256-64] - _ = x[FSRM-65] - _ = x[FXSR-66] - _ = x[FXSROPT-67] - _ = x[GFNI-68] - _ = x[HLE-69] - _ = x[HRESET-70] - _ = x[HTT-71] - _ = x[HWA-72] - _ = x[HYBRID_CPU-73] - _ = x[HYPERVISOR-74] - _ = x[IA32_ARCH_CAP-75] - _ = x[IA32_CORE_CAP-76] - _ = x[IBPB-77] - _ = x[IBPB_BRTYPE-78] - _ = x[IBRS-79] - _ = x[IBRS_PREFERRED-80] - _ = x[IBRS_PROVIDES_SMP-81] - _ = x[IBS-82] - _ = x[IBSBRNTRGT-83] - _ = x[IBSFETCHSAM-84] - _ = x[IBSFFV-85] - _ = x[IBSOPCNT-86] - _ = x[IBSOPCNTEXT-87] - _ = x[IBSOPSAM-88] - _ = x[IBSRDWROPCNT-89] - _ = x[IBSRIPINVALIDCHK-90] - _ = x[IBS_FETCH_CTLX-91] - _ = x[IBS_OPDATA4-92] - _ = x[IBS_OPFUSE-93] - _ = x[IBS_PREVENTHOST-94] - _ = x[IBS_ZEN4-95] - _ = x[IDPRED_CTRL-96] - _ = x[INT_WBINVD-97] - _ = x[INVLPGB-98] - _ = x[KEYLOCKER-99] - _ = x[KEYLOCKERW-100] - _ = x[LAHF-101] - _ = x[LAM-102] - _ = x[LBRVIRT-103] - _ = x[LZCNT-104] - _ = x[MCAOVERFLOW-105] - _ = x[MCDT_NO-106] - _ = x[MCOMMIT-107] - _ = x[MD_CLEAR-108] - _ = x[MMX-109] - _ = x[MMXEXT-110] - _ = x[MOVBE-111] - _ = x[MOVDIR64B-112] - _ = x[MOVDIRI-113] - _ = x[MOVSB_ZL-114] - _ = x[MOVU-115] - _ = x[MPX-116] - _ = x[MSRIRC-117] - _ = x[MSRLIST-118] - _ = x[MSR_PAGEFLUSH-119] - _ = x[NRIPS-120] - _ = x[NX-121] - _ = x[OSXSAVE-122] - _ = x[PCONFIG-123] - _ = x[POPCNT-124] - _ = x[PPIN-125] - _ = x[PREFETCHI-126] - _ = x[PSFD-127] - _ = x[RDPRU-128] - _ = x[RDRAND-129] - _ = x[RDSEED-130] - _ = x[RDTSCP-131] - _ = x[RRSBA_CTRL-132] - _ = x[RTM-133] - _ = x[RTM_ALWAYS_ABORT-134] - _ = x[SBPB-135] - _ = x[SERIALIZE-136] - _ = x[SEV-137] - _ = x[SEV_64BIT-138] - _ = x[SEV_ALTERNATIVE-139] - _ = x[SEV_DEBUGSWAP-140] - _ = x[SEV_ES-141] - _ = x[SEV_RESTRICTED-142] - _ = x[SEV_SNP-143] - _ = x[SGX-144] - _ = x[SGXLC-145] - _ = x[SHA-146] - _ = x[SME-147] - _ = x[SME_COHERENT-148] - _ = x[SPEC_CTRL_SSBD-149] - _ = x[SRBDS_CTRL-150] - _ = x[SRSO_MSR_FIX-151] - _ = x[SRSO_NO-152] - _ = x[SRSO_USER_KERNEL_NO-153] - _ = x[SSE-154] - _ = x[SSE2-155] - _ = x[SSE3-156] - _ = x[SSE4-157] - _ = x[SSE42-158] - _ = x[SSE4A-159] - _ = x[SSSE3-160] - _ = x[STIBP-161] - _ = x[STIBP_ALWAYSON-162] - _ = x[STOSB_SHORT-163] - _ = x[SUCCOR-164] - _ = x[SVM-165] - _ = x[SVMDA-166] - _ = x[SVMFBASID-167] - _ = x[SVML-168] - _ = x[SVMNP-169] - _ = x[SVMPF-170] - _ = x[SVMPFT-171] - _ = x[SYSCALL-172] - _ = x[SYSEE-173] - _ = x[TBM-174] - _ = x[TDX_GUEST-175] - _ = x[TLB_FLUSH_NESTED-176] - _ = x[TME-177] - _ = x[TOPEXT-178] - _ = x[TSCRATEMSR-179] - _ = x[TSXLDTRK-180] - _ = x[VAES-181] - _ = x[VMCBCLEAN-182] - _ = x[VMPL-183] - _ = x[VMSA_REGPROT-184] - _ = x[VMX-185] - _ = x[VPCLMULQDQ-186] - _ = x[VTE-187] - _ = x[WAITPKG-188] - _ = x[WBNOINVD-189] - _ = x[WRMSRNS-190] - _ = x[X87-191] - _ = x[XGETBV1-192] - _ = x[XOP-193] - _ = x[XSAVE-194] - _ = x[XSAVEC-195] - _ = x[XSAVEOPT-196] - _ = x[XSAVES-197] - _ = x[AESARM-198] - _ = x[ARMCPUID-199] - _ = x[ASIMD-200] - _ = x[ASIMDDP-201] - _ = x[ASIMDHP-202] - _ = x[ASIMDRDM-203] - _ = x[ATOMICS-204] - _ = x[CRC32-205] - _ = x[DCPOP-206] - _ = x[EVTSTRM-207] - _ = x[FCMA-208] - _ = x[FHM-209] - _ = x[FP-210] - _ = x[FPHP-211] - _ = x[GPA-212] - _ = x[JSCVT-213] - _ = x[LRCPC-214] - _ = x[PMULL-215] - _ = x[RNDR-216] - _ = x[TLB-217] - _ = x[TS-218] - _ = x[SHA1-219] - _ = x[SHA2-220] - _ = x[SHA3-221] - _ = x[SHA512-222] - _ = x[SM3-223] - _ = x[SM4-224] - _ = x[SVE-225] - _ = x[lastID-226] + _ = x[AMXTRANSPOSE-12] + _ = x[APX_F-13] + _ = x[AVX-14] + _ = x[AVX10-15] + _ = x[AVX10_128-16] + _ = x[AVX10_256-17] + _ = x[AVX10_512-18] + _ = x[AVX2-19] + _ = x[AVX512BF16-20] + _ = x[AVX512BITALG-21] + _ = x[AVX512BW-22] + _ = x[AVX512CD-23] + _ = x[AVX512DQ-24] + _ = x[AVX512ER-25] + _ = x[AVX512F-26] + _ = x[AVX512FP16-27] + _ = x[AVX512IFMA-28] + _ = x[AVX512PF-29] + _ = x[AVX512VBMI-30] + _ = x[AVX512VBMI2-31] + _ = x[AVX512VL-32] + _ = x[AVX512VNNI-33] + _ = x[AVX512VP2INTERSECT-34] + _ = x[AVX512VPOPCNTDQ-35] + _ = x[AVXIFMA-36] + _ = x[AVXNECONVERT-37] + _ = x[AVXSLOW-38] + _ = x[AVXVNNI-39] + _ = x[AVXVNNIINT8-40] + _ = x[AVXVNNIINT16-41] + _ = x[BHI_CTRL-42] + _ = x[BMI1-43] + _ = x[BMI2-44] + _ = x[CETIBT-45] + _ = x[CETSS-46] + _ = x[CLDEMOTE-47] + _ = x[CLMUL-48] + _ = x[CLZERO-49] + _ = x[CMOV-50] + _ = x[CMPCCXADD-51] + _ = x[CMPSB_SCADBS_SHORT-52] + _ = x[CMPXCHG8-53] + _ = x[CPBOOST-54] + _ = x[CPPC-55] + _ = x[CX16-56] + _ = x[EFER_LMSLE_UNS-57] + _ = x[ENQCMD-58] + _ = x[ERMS-59] + _ = x[F16C-60] + _ = x[FLUSH_L1D-61] + _ = x[FMA3-62] + _ = x[FMA4-63] + _ = x[FP128-64] + _ = x[FP256-65] + _ = x[FSRM-66] + _ = x[FXSR-67] + _ = x[FXSROPT-68] + _ = x[GFNI-69] + _ = x[HLE-70] + _ = x[HRESET-71] + _ = x[HTT-72] + _ = x[HWA-73] + _ = x[HYBRID_CPU-74] + _ = x[HYPERVISOR-75] + _ = x[IA32_ARCH_CAP-76] + _ = x[IA32_CORE_CAP-77] + _ = x[IBPB-78] + _ = x[IBPB_BRTYPE-79] + _ = x[IBRS-80] + _ = x[IBRS_PREFERRED-81] + _ = x[IBRS_PROVIDES_SMP-82] + _ = x[IBS-83] + _ = x[IBSBRNTRGT-84] + _ = x[IBSFETCHSAM-85] + _ = x[IBSFFV-86] + _ = x[IBSOPCNT-87] + _ = x[IBSOPCNTEXT-88] + _ = x[IBSOPSAM-89] + _ = x[IBSRDWROPCNT-90] + _ = x[IBSRIPINVALIDCHK-91] + _ = x[IBS_FETCH_CTLX-92] + _ = x[IBS_OPDATA4-93] + _ = x[IBS_OPFUSE-94] + _ = x[IBS_PREVENTHOST-95] + _ = x[IBS_ZEN4-96] + _ = x[IDPRED_CTRL-97] + _ = x[INT_WBINVD-98] + _ = x[INVLPGB-99] + _ = x[KEYLOCKER-100] + _ = x[KEYLOCKERW-101] + _ = x[LAHF-102] + _ = x[LAM-103] + _ = x[LBRVIRT-104] + _ = x[LZCNT-105] + _ = x[MCAOVERFLOW-106] + _ = x[MCDT_NO-107] + _ = x[MCOMMIT-108] + _ = x[MD_CLEAR-109] + _ = x[MMX-110] + _ = x[MMXEXT-111] + _ = x[MOVBE-112] + _ = x[MOVDIR64B-113] + _ = x[MOVDIRI-114] + _ = x[MOVSB_ZL-115] + _ = x[MOVU-116] + _ = x[MPX-117] + _ = x[MSRIRC-118] + _ = x[MSRLIST-119] + _ = x[MSR_PAGEFLUSH-120] + _ = x[NRIPS-121] + _ = x[NX-122] + _ = x[OSXSAVE-123] + _ = x[PCONFIG-124] + _ = x[POPCNT-125] + _ = x[PPIN-126] + _ = x[PREFETCHI-127] + _ = x[PSFD-128] + _ = x[RDPRU-129] + _ = x[RDRAND-130] + _ = x[RDSEED-131] + _ = x[RDTSCP-132] + _ = x[RRSBA_CTRL-133] + _ = x[RTM-134] + _ = x[RTM_ALWAYS_ABORT-135] + _ = x[SBPB-136] + _ = x[SERIALIZE-137] + _ = x[SEV-138] + _ = x[SEV_64BIT-139] + _ = x[SEV_ALTERNATIVE-140] + _ = x[SEV_DEBUGSWAP-141] + _ = x[SEV_ES-142] + _ = x[SEV_RESTRICTED-143] + _ = x[SEV_SNP-144] + _ = x[SGX-145] + _ = x[SGXLC-146] + _ = x[SHA-147] + _ = x[SME-148] + _ = x[SME_COHERENT-149] + _ = x[SM3_X86-150] + _ = x[SM4_X86-151] + _ = x[SPEC_CTRL_SSBD-152] + _ = x[SRBDS_CTRL-153] + _ = x[SRSO_MSR_FIX-154] + _ = x[SRSO_NO-155] + _ = x[SRSO_USER_KERNEL_NO-156] + _ = x[SSE-157] + _ = x[SSE2-158] + _ = x[SSE3-159] + _ = x[SSE4-160] + _ = x[SSE42-161] + _ = x[SSE4A-162] + _ = x[SSSE3-163] + _ = x[STIBP-164] + _ = x[STIBP_ALWAYSON-165] + _ = x[STOSB_SHORT-166] + _ = x[SUCCOR-167] + _ = x[SVM-168] + _ = x[SVMDA-169] + _ = x[SVMFBASID-170] + _ = x[SVML-171] + _ = x[SVMNP-172] + _ = x[SVMPF-173] + _ = x[SVMPFT-174] + _ = x[SYSCALL-175] + _ = x[SYSEE-176] + _ = x[TBM-177] + _ = x[TDX_GUEST-178] + _ = x[TLB_FLUSH_NESTED-179] + _ = x[TME-180] + _ = x[TOPEXT-181] + _ = x[TSCRATEMSR-182] + _ = x[TSXLDTRK-183] + _ = x[VAES-184] + _ = x[VMCBCLEAN-185] + _ = x[VMPL-186] + _ = x[VMSA_REGPROT-187] + _ = x[VMX-188] + _ = x[VPCLMULQDQ-189] + _ = x[VTE-190] + _ = x[WAITPKG-191] + _ = x[WBNOINVD-192] + _ = x[WRMSRNS-193] + _ = x[X87-194] + _ = x[XGETBV1-195] + _ = x[XOP-196] + _ = x[XSAVE-197] + _ = x[XSAVEC-198] + _ = x[XSAVEOPT-199] + _ = x[XSAVES-200] + _ = x[AESARM-201] + _ = x[ARMCPUID-202] + _ = x[ASIMD-203] + _ = x[ASIMDDP-204] + _ = x[ASIMDHP-205] + _ = x[ASIMDRDM-206] + _ = x[ATOMICS-207] + _ = x[CRC32-208] + _ = x[DCPOP-209] + _ = x[EVTSTRM-210] + _ = x[FCMA-211] + _ = x[FHM-212] + _ = x[FP-213] + _ = x[FPHP-214] + _ = x[GPA-215] + _ = x[JSCVT-216] + _ = x[LRCPC-217] + _ = x[PMULL-218] + _ = x[RNDR-219] + _ = x[TLB-220] + _ = x[TS-221] + _ = x[SHA1-222] + _ = x[SHA2-223] + _ = x[SHA3-224] + _ = x[SHA512-225] + _ = x[SM3-226] + _ = x[SM4-227] + _ = x[SVE-228] + _ = x[lastID-229] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1143, 1146, 1158, 1165, 1172, 1186, 1196, 1208, 1215, 1234, 1237, 1241, 1245, 1249, 1254, 1259, 1264, 1269, 1283, 1294, 1300, 1303, 1308, 1317, 1321, 1326, 1331, 1337, 1344, 1349, 1352, 1361, 1377, 1380, 1386, 1396, 1404, 1408, 1417, 1421, 1433, 1436, 1446, 1449, 1456, 1464, 1471, 1474, 1481, 1484, 1489, 1495, 1503, 1509, 1515, 1523, 1528, 1535, 1542, 1550, 1557, 1562, 1567, 1574, 1578, 1581, 1583, 1587, 1590, 1595, 1600, 1605, 1609, 1612, 1614, 1618, 1622, 1626, 1632, 1635, 1638, 1641, 1647} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go index 6f0b33ca6e..da07522e7c 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -65,9 +65,16 @@ func sysctlGetInt64(unknown int, names ...string) int { return unknown } -func setFeature(c *CPUInfo, name string, feature FeatureID) { - c.featureSet.setIf(sysctlGetBool(name), feature) +func setFeature(c *CPUInfo, feature FeatureID, aliases ...string) { + for _, alias := range aliases { + set := sysctlGetBool(alias) + c.featureSet.setIf(set, feature) + if set { + break + } + } } + func tryToFillCPUInfoFomSysctl(c *CPUInfo) { c.BrandName = sysctlGetString("machdep.cpu.brand_string") @@ -87,41 +94,36 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) { c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") - // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile - setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) - setFeature(c, "hw.optional.AdvSIMD", ASIMD) - setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) - setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) - setFeature(c, "hw.optional.FEAT_CRC32", CRC32) - setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) - // setFeature(c, "", EVTSTRM) - setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) - setFeature(c, "hw.optional.arm.FEAT_FHM", FHM) - setFeature(c, "hw.optional.arm.FEAT_FP", FP) - setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) - setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) - setFeature(c, "hw.optional.arm.FEAT_RNG", RNDR) - setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) - setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) - setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) - setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) - setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) - setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) - setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) - setFeature(c, "hw.optional.arm.FEAT_TLBIOS", TLB) - setFeature(c, "hw.optional.arm.FEAT_TLBIRANGE", TLB) - setFeature(c, "hw.optional.arm.FEAT_FlagM", TS) - setFeature(c, "hw.optional.arm.FEAT_FlagM2", TS) - // setFeature(c, "", SM3) - // setFeature(c, "", SM4) - setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) - - // from empirical observation - setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) - setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) - setFeature(c, "hw.optional.floatingpoint", FP) - setFeature(c, "hw.optional.armv8_2_sha3", SHA3) - setFeature(c, "hw.optional.armv8_2_sha512", SHA512) - setFeature(c, "hw.optional.armv8_3_compnum", FCMA) - setFeature(c, "hw.optional.armv8_crc32", CRC32) + // ARM features: + // + // Note: On some Apple Silicon system, some feats have aliases. See: + // https://developer.apple.com/documentation/kernel/1387446-sysctlbyname/determining_instruction_set_characteristics + // When so, we look at all aliases and consider a feature available when at least one identifier matches. + setFeature(c, AESARM, "hw.optional.arm.FEAT_AES") // AES instructions + setFeature(c, ASIMD, "hw.optional.arm.AdvSIMD", "hw.optional.neon") // Advanced SIMD + setFeature(c, ASIMDDP, "hw.optional.arm.FEAT_DotProd") // SIMD Dot Product + setFeature(c, ASIMDHP, "hw.optional.arm.AdvSIMD_HPFPCvt", "hw.optional.neon_hpfp") // Advanced SIMD half-precision floating point + setFeature(c, ASIMDRDM, "hw.optional.arm.FEAT_RDM") // Rounding Double Multiply Accumulate/Subtract + setFeature(c, ATOMICS, "hw.optional.arm.FEAT_LSE", "hw.optional.armv8_1_atomics") // Large System Extensions (LSE) + setFeature(c, CRC32, "hw.optional.arm.FEAT_CRC32", "hw.optional.armv8_crc32") // CRC32/CRC32C instructions + setFeature(c, DCPOP, "hw.optional.arm.FEAT_DPB") // Data cache clean to Point of Persistence (DC CVAP) + setFeature(c, EVTSTRM, "hw.optional.arm.FEAT_ECV") // Generic timer + setFeature(c, FCMA, "hw.optional.arm.FEAT_FCMA", "hw.optional.armv8_3_compnum") // Floating point complex number addition and multiplication + setFeature(c, FHM, "hw.optional.armv8_2_fhm", "hw.optional.arm.FEAT_FHM") // FMLAL and FMLSL instructions + setFeature(c, FP, "hw.optional.floatingpoint") // Single-precision and double-precision floating point + setFeature(c, FPHP, "hw.optional.arm.FEAT_FP16", "hw.optional.neon_fp16") // Half-precision floating point + setFeature(c, GPA, "hw.optional.arm.FEAT_PAuth") // Generic Pointer Authentication + setFeature(c, JSCVT, "hw.optional.arm.FEAT_JSCVT") // Javascript-style double->int convert (FJCVTZS) + setFeature(c, LRCPC, "hw.optional.arm.FEAT_LRCPC") // Weaker release consistency (LDAPR, etc) + setFeature(c, PMULL, "hw.optional.arm.FEAT_PMULL") // Polynomial Multiply instructions (PMULL/PMULL2) + setFeature(c, RNDR, "hw.optional.arm.FEAT_RNG") // Random Number instructions + setFeature(c, TLB, "hw.optional.arm.FEAT_TLBIOS", "hw.optional.arm.FEAT_TLBIRANGE") // Outer Shareable and TLB range maintenance instructions + setFeature(c, TS, "hw.optional.arm.FEAT_FlagM", "hw.optional.arm.FEAT_FlagM2") // Flag manipulation instructions + setFeature(c, SHA1, "hw.optional.arm.FEAT_SHA1") // SHA-1 instructions (SHA1C, etc) + setFeature(c, SHA2, "hw.optional.arm.FEAT_SHA256") // SHA-2 instructions (SHA256H, etc) + setFeature(c, SHA3, "hw.optional.arm.FEAT_SHA3") // SHA-3 instructions (EOR3, RAXI, XAR, BCAX) + setFeature(c, SHA512, "hw.optional.arm.FEAT_SHA512") // SHA512 instructions + setFeature(c, SM3, "hw.optional.arm.FEAT_SM3") // SM3 instructions + setFeature(c, SM4, "hw.optional.arm.FEAT_SM4") // SM4 instructions + setFeature(c, SVE, "hw.optional.arm.FEAT_SVE") // Scalable Vector Extension } diff --git a/vendor/go.opentelemetry.io/otel/.clomonitor.yml b/vendor/go.opentelemetry.io/otel/.clomonitor.yml new file mode 100644 index 0000000000..128d61a226 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/.clomonitor.yml @@ -0,0 +1,3 @@ +exemptions: + - check: artifacthub_badge + reason: "Artifact Hub doesn't support Go packages" diff --git a/vendor/go.opentelemetry.io/otel/.golangci.yml b/vendor/go.opentelemetry.io/otel/.golangci.yml index 888e5da802..5f69cc027c 100644 --- a/vendor/go.opentelemetry.io/otel/.golangci.yml +++ b/vendor/go.opentelemetry.io/otel/.golangci.yml @@ -66,8 +66,6 @@ linters: desc: Do not use cross-module internal packages. - pkg: go.opentelemetry.io/otel/internal/internaltest desc: Do not use cross-module internal packages. - - pkg: go.opentelemetry.io/otel/internal/matchers - desc: Do not use cross-module internal packages. otlp-internal: files: - '!**/exporters/otlp/internal/**/*.go' @@ -190,6 +188,10 @@ linters: - legacy - std-error-handling rules: + - linters: + - revive + path: schema/v.*/types/.* + text: avoid meaningless package names # TODO: Having appropriate comments for exported objects helps development, # even for objects in internal packages. Appropriate comments for all # exported objects should be added and this exclusion removed. diff --git a/vendor/go.opentelemetry.io/otel/CHANGELOG.md b/vendor/go.opentelemetry.io/otel/CHANGELOG.md index 648e4abab8..4acc75701b 100644 --- a/vendor/go.opentelemetry.io/otel/CHANGELOG.md +++ b/vendor/go.opentelemetry.io/otel/CHANGELOG.md @@ -11,6 +11,61 @@ This project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.htm +## [1.37.0/0.59.0/0.13.0] 2025-06-25 + +### Added + +- The `go.opentelemetry.io/otel/semconv/v1.33.0` package. + The package contains semantic conventions from the `v1.33.0` version of the OpenTelemetry Semantic Conventions. + See the [migration documentation](./semconv/v1.33.0/MIGRATION.md) for information on how to upgrade from `go.opentelemetry.io/otel/semconv/v1.32.0.`(#6799) +- The `go.opentelemetry.io/otel/semconv/v1.34.0` package. + The package contains semantic conventions from the `v1.34.0` version of the OpenTelemetry Semantic Conventions. (#6812) +- Add metric's schema URL as `otel_scope_schema_url` label in `go.opentelemetry.io/otel/exporters/prometheus`. (#5947) +- Add metric's scope attributes as `otel_scope_[attribute]` labels in `go.opentelemetry.io/otel/exporters/prometheus`. (#5947) +- Add `EventName` to `EnabledParameters` in `go.opentelemetry.io/otel/log`. (#6825) +- Add `EventName` to `EnabledParameters` in `go.opentelemetry.io/otel/sdk/log`. (#6825) +- Changed handling of `go.opentelemetry.io/otel/exporters/prometheus` metric renaming to add unit suffixes when it doesn't match one of the pre-defined values in the unit suffix map. (#6839) + +### Changed + +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/bridge/opentracing`. (#6827) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/exporters/zipkin`. (#6829) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/metric`. (#6832) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/sdk/resource`. (#6834) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/sdk/trace`. (#6835) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/trace`. (#6836) +- `Record.Resource` now returns `*resource.Resource` instead of `resource.Resource` in `go.opentelemetry.io/otel/sdk/log`. (#6864) +- Retry now shows error cause for context timeout in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp`, `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp`, `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp`. (#6898) + +### Fixed + +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc`. (#6710) +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp`. (#6710) +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc`. (#6710) +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp`. (#6710) +- Validate exponential histogram scale range for Prometheus compatibility in `go.opentelemetry.io/otel/exporters/prometheus`. (#6822) +- Context cancellation during metric pipeline produce does not corrupt data in `go.opentelemetry.io/otel/sdk/metric`. (#6914) + +### Removed + +- `go.opentelemetry.io/otel/exporters/prometheus` no longer exports `otel_scope_info` metric. (#6770) + +## [0.12.2] 2025-05-22 + +### Fixed + +- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc` module that contains invalid dependencies. (#6804) +- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp` module that contains invalid dependencies. (#6804) +- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/stdout/stdoutlog` module that contains invalid dependencies. (#6804) + +## [0.12.1] 2025-05-21 + +### Fixes + +- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc`. (#6800) +- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp`. (#6800) +- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/stdout/stdoutlog`. (#6800) + ## [1.36.0/0.58.0/0.12.0] 2025-05-20 ### Added @@ -3288,7 +3343,10 @@ It contains api and sdk for trace and meter. - CircleCI build CI manifest files. - CODEOWNERS file to track owners of this project. -[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.36.0...HEAD +[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.37.0...HEAD +[1.37.0/0.59.0/0.13.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.37.0 +[0.12.2]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/log/v0.12.2 +[0.12.1]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/log/v0.12.1 [1.36.0/0.58.0/0.12.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.36.0 [1.35.0/0.57.0/0.11.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.35.0 [1.34.0/0.56.0/0.10.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.34.0 diff --git a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md index 1902dac057..f9ddc281fc 100644 --- a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md +++ b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md @@ -109,10 +109,9 @@ A PR is considered **ready to merge** when: This is not enforced through automation, but needs to be validated by the maintainer merging. - * The qualified approvals need to be from [Approver]s/[Maintainer]s - affiliated with different companies. Two qualified approvals from - [Approver]s or [Maintainer]s affiliated with the same company counts as a - single qualified approval. + * At least one of the qualified approvals need to be from an + [Approver]/[Maintainer] affiliated with a different company than the author + of the PR. * PRs introducing changes that have already been discussed and consensus reached only need one qualified approval. The discussion and resolution needs to be linked to the PR. @@ -650,11 +649,11 @@ should be canceled. ### Maintainers -- [Damien Mathieu](https://github.com/dmathieu), Elastic -- [David Ashpole](https://github.com/dashpole), Google -- [Robert Pająk](https://github.com/pellared), Splunk -- [Sam Xie](https://github.com/XSAM), Cisco/AppDynamics -- [Tyler Yahn](https://github.com/MrAlias), Splunk +- [Damien Mathieu](https://github.com/dmathieu), Elastic ([GPG](https://keys.openpgp.org/search?q=5A126B972A81A6CE443E5E1B408B8E44F0873832)) +- [David Ashpole](https://github.com/dashpole), Google ([GPG](https://keys.openpgp.org/search?q=C0D1BDDCAAEAE573673085F176327DA4D864DC70)) +- [Robert Pająk](https://github.com/pellared), Splunk ([GPG](https://keys.openpgp.org/search?q=CDAD3A60476A3DE599AA5092E5F7C35A4DBE90C2)) +- [Sam Xie](https://github.com/XSAM), Splunk ([GPG](https://keys.openpgp.org/search?q=AEA033782371ABB18EE39188B8044925D6FEEBEA)) +- [Tyler Yahn](https://github.com/MrAlias), Splunk ([GPG](https://keys.openpgp.org/search?q=0x46B0F3E1A8B1BA5A)) ### Emeritus diff --git a/vendor/go.opentelemetry.io/otel/Makefile b/vendor/go.opentelemetry.io/otel/Makefile index 62a56f4d34..4fa423ca02 100644 --- a/vendor/go.opentelemetry.io/otel/Makefile +++ b/vendor/go.opentelemetry.io/otel/Makefile @@ -293,7 +293,7 @@ semconv-generate: $(SEMCONVKIT) --param tag=$(TAG) \ go \ /home/weaver/target - $(SEMCONVKIT) -output "$(SEMCONVPKG)/$(TAG)" -tag "$(TAG)" + $(SEMCONVKIT) -semconv "$(SEMCONVPKG)" -tag "$(TAG)" .PHONY: gorelease gorelease: $(OTEL_GO_MOD_DIRS:%=gorelease/%) diff --git a/vendor/go.opentelemetry.io/otel/README.md b/vendor/go.opentelemetry.io/otel/README.md index b600788121..5fa1b75c60 100644 --- a/vendor/go.opentelemetry.io/otel/README.md +++ b/vendor/go.opentelemetry.io/otel/README.md @@ -7,6 +7,7 @@ [![OpenSSF Scorecard](https://api.scorecard.dev/projects/github.com/open-telemetry/opentelemetry-go/badge)](https://scorecard.dev/viewer/?uri=github.com/open-telemetry/opentelemetry-go) [![OpenSSF Best Practices](https://www.bestpractices.dev/projects/9996/badge)](https://www.bestpractices.dev/projects/9996) [![Fuzzing Status](https://oss-fuzz-build-logs.storage.googleapis.com/badges/opentelemetry-go.svg)](https://issues.oss-fuzz.com/issues?q=project:opentelemetry-go) +[![FOSSA Status](https://app.fossa.com/api/projects/custom%2B162%2Fgithub.com%2Fopen-telemetry%2Fopentelemetry-go.svg?type=shield&issueType=license)](https://app.fossa.com/projects/custom%2B162%2Fgithub.com%2Fopen-telemetry%2Fopentelemetry-go?ref=badge_shield&issueType=license) [![Slack](https://img.shields.io/badge/slack-@cncf/otel--go-brightgreen.svg?logo=slack)](https://cloud-native.slack.com/archives/C01NPAXACKT) OpenTelemetry-Go is the [Go](https://golang.org/) implementation of [OpenTelemetry](https://opentelemetry.io/). diff --git a/vendor/go.opentelemetry.io/otel/RELEASING.md b/vendor/go.opentelemetry.io/otel/RELEASING.md index 7c1a9119dc..1ddcdef039 100644 --- a/vendor/go.opentelemetry.io/otel/RELEASING.md +++ b/vendor/go.opentelemetry.io/otel/RELEASING.md @@ -112,6 +112,29 @@ It is critical you make sure the version you push upstream is correct. Finally create a Release for the new `` on GitHub. The release body should include all the release notes from the Changelog for this release. +### Sign the Release Artifact + +To ensure we comply with CNCF best practices, we need to sign the release artifact. +The tarball attached to the GitHub release needs to be signed with your GPG key. + +Follow [these steps] to sign the release artifact and upload it to GitHub. +You can use [this script] to verify the contents of the tarball before signing it. + +Be sure to use the correct GPG key when signing the release artifact. + +```terminal +gpg --local-user --armor --detach-sign opentelemetry-go-.tar.gz +``` + +You can verify the signature with: + +```terminal +gpg --verify opentelemetry-go-.tar.gz.asc opentelemetry-go-.tar.gz +``` + +[these steps]: https://wiki.debian.org/Creating%20signed%20GitHub%20releases +[this script]: https://github.com/MrAlias/attest-sh + ## Post-Release ### Contrib Repository diff --git a/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile b/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile index 51fb76b30d..935bd48763 100644 --- a/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile +++ b/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile @@ -1,4 +1,4 @@ # This is a renovate-friendly source of Docker images. -FROM python:3.13.3-slim-bullseye@sha256:9e3f9243e06fd68eb9519074b49878eda20ad39a855fac51aaffb741de20726e AS python -FROM otel/weaver:v0.15.0@sha256:1cf1c72eaed57dad813c2e359133b8a15bd4facf305aae5b13bdca6d3eccff56 AS weaver +FROM python:3.13.5-slim-bullseye@sha256:5b9fc0d8ef79cfb5f300e61cb516e0c668067bbf77646762c38c94107e230dbc AS python +FROM otel/weaver:v0.15.2@sha256:b13acea09f721774daba36344861f689ac4bb8d6ecd94c4600b4d590c8fb34b9 AS weaver FROM avtodev/markdown-lint:v1@sha256:6aeedc2f49138ce7a1cd0adffc1b1c0321b841dc2102408967d9301c031949ee AS markdown diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md new file mode 100644 index 0000000000..02b56115e3 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md @@ -0,0 +1,4 @@ + +# Migration from v1.33.0 to v1.34.0 + +The `go.opentelemetry.io/otel/semconv/v1.34.0` package should be a drop-in replacement for `go.opentelemetry.io/otel/semconv/v1.33.0`. diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md new file mode 100644 index 0000000000..fab06c9752 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md @@ -0,0 +1,3 @@ +# Semconv v1.34.0 + +[![PkgGoDev](https://pkg.go.dev/badge/go.opentelemetry.io/otel/semconv/v1.34.0)](https://pkg.go.dev/go.opentelemetry.io/otel/semconv/v1.34.0) diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go new file mode 100644 index 0000000000..5b56662573 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go @@ -0,0 +1,13851 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +// Code generated from semantic convention specification. DO NOT EDIT. + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" + +import "go.opentelemetry.io/otel/attribute" + +// Namespace: android +const ( + // AndroidAppStateKey is the attribute Key conforming to the "android.app.state" + // semantic conventions. It represents the this attribute represents the state + // of the application. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "created" + // Note: The Android lifecycle states are defined in + // [Activity lifecycle callbacks], and from which the `OS identifiers` are + // derived. + // + // [Activity lifecycle callbacks]: https://developer.android.com/guide/components/activities/activity-lifecycle#lc + AndroidAppStateKey = attribute.Key("android.app.state") + + // AndroidOSAPILevelKey is the attribute Key conforming to the + // "android.os.api_level" semantic conventions. It represents the uniquely + // identifies the framework API revision offered by a version (`os.version`) of + // the android operating system. More information can be found [here]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "33", "32" + // + // [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels + AndroidOSAPILevelKey = attribute.Key("android.os.api_level") +) + +// AndroidOSAPILevel returns an attribute KeyValue conforming to the +// "android.os.api_level" semantic conventions. It represents the uniquely +// identifies the framework API revision offered by a version (`os.version`) of +// the android operating system. More information can be found [here]. +// +// [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels +func AndroidOSAPILevel(val string) attribute.KeyValue { + return AndroidOSAPILevelKey.String(val) +} + +// Enum values for android.app.state +var ( + // Any time before Activity.onResume() or, if the app has no Activity, + // Context.startService() has been called in the app for the first time. + // + // Stability: development + AndroidAppStateCreated = AndroidAppStateKey.String("created") + // Any time after Activity.onPause() or, if the app has no Activity, + // Context.stopService() has been called when the app was in the foreground + // state. + // + // Stability: development + AndroidAppStateBackground = AndroidAppStateKey.String("background") + // Any time after Activity.onResume() or, if the app has no Activity, + // Context.startService() has been called when the app was in either the created + // or background states. + // + // Stability: development + AndroidAppStateForeground = AndroidAppStateKey.String("foreground") +) + +// Namespace: app +const ( + // AppInstallationIDKey is the attribute Key conforming to the + // "app.installation.id" semantic conventions. It represents a unique identifier + // representing the installation of an application on a specific device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2ab2916d-a51f-4ac8-80ee-45ac31a28092" + // Note: Its value SHOULD persist across launches of the same application + // installation, including through application upgrades. + // It SHOULD change if the application is uninstalled or if all applications of + // the vendor are uninstalled. + // Additionally, users might be able to reset this value (e.g. by clearing + // application data). + // If an app is installed multiple times on the same device (e.g. in different + // accounts on Android), each `app.installation.id` SHOULD have a different + // value. + // If multiple OpenTelemetry SDKs are used within the same application, they + // SHOULD use the same value for `app.installation.id`. + // Hardware IDs (e.g. serial number, IMEI, MAC address) MUST NOT be used as the + // `app.installation.id`. + // + // For iOS, this value SHOULD be equal to the [vendor identifier]. + // + // For Android, examples of `app.installation.id` implementations include: + // + // - [Firebase Installation ID]. + // - A globally unique UUID which is persisted across sessions in your + // application. + // - [App set ID]. + // - [`Settings.getString(Settings.Secure.ANDROID_ID)`]. + // + // More information about Android identifier best practices can be found [here] + // . + // + // [vendor identifier]: https://developer.apple.com/documentation/uikit/uidevice/identifierforvendor + // [Firebase Installation ID]: https://firebase.google.com/docs/projects/manage-installations + // [App set ID]: https://developer.android.com/identity/app-set-id + // [`Settings.getString(Settings.Secure.ANDROID_ID)`]: https://developer.android.com/reference/android/provider/Settings.Secure#ANDROID_ID + // [here]: https://developer.android.com/training/articles/user-data-ids + AppInstallationIDKey = attribute.Key("app.installation.id") + + // AppScreenCoordinateXKey is the attribute Key conforming to the + // "app.screen.coordinate.x" semantic conventions. It represents the x + // (horizontal) coordinate of a screen coordinate, in screen pixels. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 131 + AppScreenCoordinateXKey = attribute.Key("app.screen.coordinate.x") + + // AppScreenCoordinateYKey is the attribute Key conforming to the + // "app.screen.coordinate.y" semantic conventions. It represents the y + // (vertical) component of a screen coordinate, in screen pixels. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12, 99 + AppScreenCoordinateYKey = attribute.Key("app.screen.coordinate.y") + + // AppWidgetIDKey is the attribute Key conforming to the "app.widget.id" + // semantic conventions. It represents an identifier that uniquely + // differentiates this widget from other widgets in the same application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "f9bc787d-ff05-48ad-90e1-fca1d46130b3", "submit_order_1829" + // Note: A widget is an application component, typically an on-screen visual GUI + // element. + AppWidgetIDKey = attribute.Key("app.widget.id") + + // AppWidgetNameKey is the attribute Key conforming to the "app.widget.name" + // semantic conventions. It represents the name of an application widget. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "submit", "attack", "Clear Cart" + // Note: A widget is an application component, typically an on-screen visual GUI + // element. + AppWidgetNameKey = attribute.Key("app.widget.name") +) + +// AppInstallationID returns an attribute KeyValue conforming to the +// "app.installation.id" semantic conventions. It represents a unique identifier +// representing the installation of an application on a specific device. +func AppInstallationID(val string) attribute.KeyValue { + return AppInstallationIDKey.String(val) +} + +// AppScreenCoordinateX returns an attribute KeyValue conforming to the +// "app.screen.coordinate.x" semantic conventions. It represents the x +// (horizontal) coordinate of a screen coordinate, in screen pixels. +func AppScreenCoordinateX(val int) attribute.KeyValue { + return AppScreenCoordinateXKey.Int(val) +} + +// AppScreenCoordinateY returns an attribute KeyValue conforming to the +// "app.screen.coordinate.y" semantic conventions. It represents the y (vertical) +// component of a screen coordinate, in screen pixels. +func AppScreenCoordinateY(val int) attribute.KeyValue { + return AppScreenCoordinateYKey.Int(val) +} + +// AppWidgetID returns an attribute KeyValue conforming to the "app.widget.id" +// semantic conventions. It represents an identifier that uniquely differentiates +// this widget from other widgets in the same application. +func AppWidgetID(val string) attribute.KeyValue { + return AppWidgetIDKey.String(val) +} + +// AppWidgetName returns an attribute KeyValue conforming to the +// "app.widget.name" semantic conventions. It represents the name of an +// application widget. +func AppWidgetName(val string) attribute.KeyValue { + return AppWidgetNameKey.String(val) +} + +// Namespace: artifact +const ( + // ArtifactAttestationFilenameKey is the attribute Key conforming to the + // "artifact.attestation.filename" semantic conventions. It represents the + // provenance filename of the built attestation which directly relates to the + // build artifact filename. This filename SHOULD accompany the artifact at + // publish time. See the [SLSA Relationship] specification for more information. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "golang-binary-amd64-v0.1.0.attestation", + // "docker-image-amd64-v0.1.0.intoto.json1", "release-1.tar.gz.attestation", + // "file-name-package.tar.gz.intoto.json1" + // + // [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations + ArtifactAttestationFilenameKey = attribute.Key("artifact.attestation.filename") + + // ArtifactAttestationHashKey is the attribute Key conforming to the + // "artifact.attestation.hash" semantic conventions. It represents the full + // [hash value (see glossary)], of the built attestation. Some envelopes in the + // [software attestation space] also refer to this as the **digest**. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1b31dfcd5b7f9267bf2ff47651df1cfb9147b9e4df1f335accf65b4cda498408" + // + // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec + ArtifactAttestationHashKey = attribute.Key("artifact.attestation.hash") + + // ArtifactAttestationIDKey is the attribute Key conforming to the + // "artifact.attestation.id" semantic conventions. It represents the id of the + // build [software attestation]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123" + // + // [software attestation]: https://slsa.dev/attestation-model + ArtifactAttestationIDKey = attribute.Key("artifact.attestation.id") + + // ArtifactFilenameKey is the attribute Key conforming to the + // "artifact.filename" semantic conventions. It represents the human readable + // file name of the artifact, typically generated during build and release + // processes. Often includes the package name and version in the file name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "golang-binary-amd64-v0.1.0", "docker-image-amd64-v0.1.0", + // "release-1.tar.gz", "file-name-package.tar.gz" + // Note: This file name can also act as the [Package Name] + // in cases where the package ecosystem maps accordingly. + // Additionally, the artifact [can be published] + // for others, but that is not a guarantee. + // + // [Package Name]: https://slsa.dev/spec/v1.0/terminology#package-model + // [can be published]: https://slsa.dev/spec/v1.0/terminology#software-supply-chain + ArtifactFilenameKey = attribute.Key("artifact.filename") + + // ArtifactHashKey is the attribute Key conforming to the "artifact.hash" + // semantic conventions. It represents the full [hash value (see glossary)], + // often found in checksum.txt on a release of the artifact and used to verify + // package integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9ff4c52759e2c4ac70b7d517bc7fcdc1cda631ca0045271ddd1b192544f8a3e9" + // Note: The specific algorithm used to create the cryptographic hash value is + // not defined. In situations where an artifact has multiple + // cryptographic hashes, it is up to the implementer to choose which + // hash value to set here; this should be the most secure hash algorithm + // that is suitable for the situation and consistent with the + // corresponding attestation. The implementer can then provide the other + // hash values through an additional set of attribute extensions as they + // deem necessary. + // + // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + ArtifactHashKey = attribute.Key("artifact.hash") + + // ArtifactPurlKey is the attribute Key conforming to the "artifact.purl" + // semantic conventions. It represents the [Package URL] of the + // [package artifact] provides a standard way to identify and locate the + // packaged artifact. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pkg:github/package-url/purl-spec@1209109710924", + // "pkg:npm/foo@12.12.3" + // + // [Package URL]: https://github.com/package-url/purl-spec + // [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model + ArtifactPurlKey = attribute.Key("artifact.purl") + + // ArtifactVersionKey is the attribute Key conforming to the "artifact.version" + // semantic conventions. It represents the version of the artifact. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "v0.1.0", "1.2.1", "122691-build" + ArtifactVersionKey = attribute.Key("artifact.version") +) + +// ArtifactAttestationFilename returns an attribute KeyValue conforming to the +// "artifact.attestation.filename" semantic conventions. It represents the +// provenance filename of the built attestation which directly relates to the +// build artifact filename. This filename SHOULD accompany the artifact at +// publish time. See the [SLSA Relationship] specification for more information. +// +// [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations +func ArtifactAttestationFilename(val string) attribute.KeyValue { + return ArtifactAttestationFilenameKey.String(val) +} + +// ArtifactAttestationHash returns an attribute KeyValue conforming to the +// "artifact.attestation.hash" semantic conventions. It represents the full +// [hash value (see glossary)], of the built attestation. Some envelopes in the +// [software attestation space] also refer to this as the **digest**. +// +// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf +// [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec +func ArtifactAttestationHash(val string) attribute.KeyValue { + return ArtifactAttestationHashKey.String(val) +} + +// ArtifactAttestationID returns an attribute KeyValue conforming to the +// "artifact.attestation.id" semantic conventions. It represents the id of the +// build [software attestation]. +// +// [software attestation]: https://slsa.dev/attestation-model +func ArtifactAttestationID(val string) attribute.KeyValue { + return ArtifactAttestationIDKey.String(val) +} + +// ArtifactFilename returns an attribute KeyValue conforming to the +// "artifact.filename" semantic conventions. It represents the human readable +// file name of the artifact, typically generated during build and release +// processes. Often includes the package name and version in the file name. +func ArtifactFilename(val string) attribute.KeyValue { + return ArtifactFilenameKey.String(val) +} + +// ArtifactHash returns an attribute KeyValue conforming to the "artifact.hash" +// semantic conventions. It represents the full [hash value (see glossary)], +// often found in checksum.txt on a release of the artifact and used to verify +// package integrity. +// +// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf +func ArtifactHash(val string) attribute.KeyValue { + return ArtifactHashKey.String(val) +} + +// ArtifactPurl returns an attribute KeyValue conforming to the "artifact.purl" +// semantic conventions. It represents the [Package URL] of the +// [package artifact] provides a standard way to identify and locate the packaged +// artifact. +// +// [Package URL]: https://github.com/package-url/purl-spec +// [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model +func ArtifactPurl(val string) attribute.KeyValue { + return ArtifactPurlKey.String(val) +} + +// ArtifactVersion returns an attribute KeyValue conforming to the +// "artifact.version" semantic conventions. It represents the version of the +// artifact. +func ArtifactVersion(val string) attribute.KeyValue { + return ArtifactVersionKey.String(val) +} + +// Namespace: aws +const ( + // AWSBedrockGuardrailIDKey is the attribute Key conforming to the + // "aws.bedrock.guardrail.id" semantic conventions. It represents the unique + // identifier of the AWS Bedrock Guardrail. A [guardrail] helps safeguard and + // prevent unwanted behavior from model responses or user messages. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "sgi5gkybzqak" + // + // [guardrail]: https://docs.aws.amazon.com/bedrock/latest/userguide/guardrails.html + AWSBedrockGuardrailIDKey = attribute.Key("aws.bedrock.guardrail.id") + + // AWSBedrockKnowledgeBaseIDKey is the attribute Key conforming to the + // "aws.bedrock.knowledge_base.id" semantic conventions. It represents the + // unique identifier of the AWS Bedrock Knowledge base. A [knowledge base] is a + // bank of information that can be queried by models to generate more relevant + // responses and augment prompts. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "XFWUPB9PAW" + // + // [knowledge base]: https://docs.aws.amazon.com/bedrock/latest/userguide/knowledge-base.html + AWSBedrockKnowledgeBaseIDKey = attribute.Key("aws.bedrock.knowledge_base.id") + + // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to the + // "aws.dynamodb.attribute_definitions" semantic conventions. It represents the + // JSON-serialized value of each item in the `AttributeDefinitions` request + // field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "AttributeName": "string", "AttributeType": "string" }" + AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions") + + // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the + // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the + // value of the `AttributesToGet` request parameter. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "lives", "id" + AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get") + + // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the + // "aws.dynamodb.consistent_read" semantic conventions. It represents the value + // of the `ConsistentRead` request parameter. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read") + + // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the + // JSON-serialized value of each item in the `ConsumedCapacity` response field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "CapacityUnits": number, "GlobalSecondaryIndexes": { "string" : + // { "CapacityUnits": number, "ReadCapacityUnits": number, "WriteCapacityUnits": + // number } }, "LocalSecondaryIndexes": { "string" : { "CapacityUnits": number, + // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }, + // "ReadCapacityUnits": number, "Table": { "CapacityUnits": number, + // "ReadCapacityUnits": number, "WriteCapacityUnits": number }, "TableName": + // "string", "WriteCapacityUnits": number }" + AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity") + + // AWSDynamoDBCountKey is the attribute Key conforming to the + // "aws.dynamodb.count" semantic conventions. It represents the value of the + // `Count` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count") + + // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the + // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the + // value of the `ExclusiveStartTableName` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Users", "CatsTable" + AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table") + + // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key conforming to + // the "aws.dynamodb.global_secondary_index_updates" semantic conventions. It + // represents the JSON-serialized value of each item in the + // `GlobalSecondaryIndexUpdates` request field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "Create": { "IndexName": "string", "KeySchema": [ { + // "AttributeName": "string", "KeyType": "string" } ], "Projection": { + // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" }, + // "ProvisionedThroughput": { "ReadCapacityUnits": number, "WriteCapacityUnits": + // number } }" + AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates") + + // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to the + // "aws.dynamodb.global_secondary_indexes" semantic conventions. It represents + // the JSON-serialized value of each item of the `GlobalSecondaryIndexes` + // request field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "IndexName": "string", "KeySchema": [ { "AttributeName": + // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ + // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": { + // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }" + AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes") + + // AWSDynamoDBIndexNameKey is the attribute Key conforming to the + // "aws.dynamodb.index_name" semantic conventions. It represents the value of + // the `IndexName` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "name_to_group" + AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name") + + // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to the + // "aws.dynamodb.item_collection_metrics" semantic conventions. It represents + // the JSON-serialized value of the `ItemCollectionMetrics` response field. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "string" : [ { "ItemCollectionKey": { "string" : { "B": blob, + // "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": { "string" : + // "AttributeValue" }, "N": "string", "NS": [ "string" ], "NULL": boolean, "S": + // "string", "SS": [ "string" ] } }, "SizeEstimateRangeGB": [ number ] } ] }" + AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics") + + // AWSDynamoDBLimitKey is the attribute Key conforming to the + // "aws.dynamodb.limit" semantic conventions. It represents the value of the + // `Limit` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit") + + // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to the + // "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents + // the JSON-serialized value of each item of the `LocalSecondaryIndexes` request + // field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "IndexArn": "string", "IndexName": "string", "IndexSizeBytes": + // number, "ItemCount": number, "KeySchema": [ { "AttributeName": "string", + // "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ "string" ], + // "ProjectionType": "string" } }" + AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes") + + // AWSDynamoDBProjectionKey is the attribute Key conforming to the + // "aws.dynamodb.projection" semantic conventions. It represents the value of + // the `ProjectionExpression` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Title", "Title, Price, Color", "Title, Description, RelatedItems, + // ProductReviews" + AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection") + + // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.provisioned_read_capacity" semantic conventions. It represents + // the value of the `ProvisionedThroughput.ReadCapacityUnits` request parameter. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0, 2.0 + AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity") + + // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.provisioned_write_capacity" semantic conventions. It represents + // the value of the `ProvisionedThroughput.WriteCapacityUnits` request + // parameter. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0, 2.0 + AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity") + + // AWSDynamoDBScanForwardKey is the attribute Key conforming to the + // "aws.dynamodb.scan_forward" semantic conventions. It represents the value of + // the `ScanIndexForward` request parameter. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward") + + // AWSDynamoDBScannedCountKey is the attribute Key conforming to the + // "aws.dynamodb.scanned_count" semantic conventions. It represents the value of + // the `ScannedCount` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 50 + AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count") + + // AWSDynamoDBSegmentKey is the attribute Key conforming to the + // "aws.dynamodb.segment" semantic conventions. It represents the value of the + // `Segment` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment") + + // AWSDynamoDBSelectKey is the attribute Key conforming to the + // "aws.dynamodb.select" semantic conventions. It represents the value of the + // `Select` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ALL_ATTRIBUTES", "COUNT" + AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select") + + // AWSDynamoDBTableCountKey is the attribute Key conforming to the + // "aws.dynamodb.table_count" semantic conventions. It represents the number of + // items in the `TableNames` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 20 + AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count") + + // AWSDynamoDBTableNamesKey is the attribute Key conforming to the + // "aws.dynamodb.table_names" semantic conventions. It represents the keys in + // the `RequestItems` object field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Users", "Cats" + AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names") + + // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the + // "aws.dynamodb.total_segments" semantic conventions. It represents the value + // of the `TotalSegments` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments") + + // AWSECSClusterARNKey is the attribute Key conforming to the + // "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an + // [ECS cluster]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster" + // + // [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html + AWSECSClusterARNKey = attribute.Key("aws.ecs.cluster.arn") + + // AWSECSContainerARNKey is the attribute Key conforming to the + // "aws.ecs.container.arn" semantic conventions. It represents the Amazon + // Resource Name (ARN) of an [ECS container instance]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:ecs:us-west-1:123456789123:container/32624152-9086-4f0e-acae-1a75b14fe4d9" + // + // [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html + AWSECSContainerARNKey = attribute.Key("aws.ecs.container.arn") + + // AWSECSLaunchtypeKey is the attribute Key conforming to the + // "aws.ecs.launchtype" semantic conventions. It represents the [launch type] + // for an ECS task. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [launch type]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/launch_types.html + AWSECSLaunchtypeKey = attribute.Key("aws.ecs.launchtype") + + // AWSECSTaskARNKey is the attribute Key conforming to the "aws.ecs.task.arn" + // semantic conventions. It represents the ARN of a running [ECS task]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:ecs:us-west-1:123456789123:task/10838bed-421f-43ef-870a-f43feacbbb5b", + // "arn:aws:ecs:us-west-1:123456789123:task/my-cluster/task-id/23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd" + // + // [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids + AWSECSTaskARNKey = attribute.Key("aws.ecs.task.arn") + + // AWSECSTaskFamilyKey is the attribute Key conforming to the + // "aws.ecs.task.family" semantic conventions. It represents the family name of + // the [ECS task definition] used to create the ECS task. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-family" + // + // [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html + AWSECSTaskFamilyKey = attribute.Key("aws.ecs.task.family") + + // AWSECSTaskIDKey is the attribute Key conforming to the "aws.ecs.task.id" + // semantic conventions. It represents the ID of a running ECS task. The ID MUST + // be extracted from `task.arn`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "10838bed-421f-43ef-870a-f43feacbbb5b", + // "23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd" + AWSECSTaskIDKey = attribute.Key("aws.ecs.task.id") + + // AWSECSTaskRevisionKey is the attribute Key conforming to the + // "aws.ecs.task.revision" semantic conventions. It represents the revision for + // the task definition used to create the ECS task. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "8", "26" + AWSECSTaskRevisionKey = attribute.Key("aws.ecs.task.revision") + + // AWSEKSClusterARNKey is the attribute Key conforming to the + // "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS + // cluster. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster" + AWSEKSClusterARNKey = attribute.Key("aws.eks.cluster.arn") + + // AWSExtendedRequestIDKey is the attribute Key conforming to the + // "aws.extended_request_id" semantic conventions. It represents the AWS + // extended request ID as returned in the response header `x-amz-id-2`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "wzHcyEWfmOGDIE5QOhTAqFDoDWP3y8IUvpNINCwL9N4TEHbUw0/gZJ+VZTmCNCWR7fezEN3eCiQ=" + AWSExtendedRequestIDKey = attribute.Key("aws.extended_request_id") + + // AWSKinesisStreamNameKey is the attribute Key conforming to the + // "aws.kinesis.stream_name" semantic conventions. It represents the name of the + // AWS Kinesis [stream] the request refers to. Corresponds to the + // `--stream-name` parameter of the Kinesis [describe-stream] operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "some-stream-name" + // + // [stream]: https://docs.aws.amazon.com/streams/latest/dev/introduction.html + // [describe-stream]: https://docs.aws.amazon.com/cli/latest/reference/kinesis/describe-stream.html + AWSKinesisStreamNameKey = attribute.Key("aws.kinesis.stream_name") + + // AWSLambdaInvokedARNKey is the attribute Key conforming to the + // "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked + // ARN as provided on the `Context` passed to the function ( + // `Lambda-Runtime-Invoked-Function-Arn` header on the + // `/runtime/invocation/next` applicable). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:lambda:us-east-1:123456:function:myfunction:myalias" + // Note: This may be different from `cloud.resource_id` if an alias is involved. + AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn") + + // AWSLambdaResourceMappingIDKey is the attribute Key conforming to the + // "aws.lambda.resource_mapping.id" semantic conventions. It represents the UUID + // of the [AWS Lambda EvenSource Mapping]. An event source is mapped to a lambda + // function. It's contents are read by Lambda and used to trigger a function. + // This isn't available in the lambda execution context or the lambda runtime + // environtment. This is going to be populated by the AWS SDK for each language + // when that UUID is present. Some of these operations are + // Create/Delete/Get/List/Update EventSourceMapping. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "587ad24b-03b9-4413-8202-bbd56b36e5b7" + // + // [AWS Lambda EvenSource Mapping]: https://docs.aws.amazon.com/AWSCloudFormation/latest/UserGuide/aws-resource-lambda-eventsourcemapping.html + AWSLambdaResourceMappingIDKey = attribute.Key("aws.lambda.resource_mapping.id") + + // AWSLogGroupARNsKey is the attribute Key conforming to the + // "aws.log.group.arns" semantic conventions. It represents the Amazon Resource + // Name(s) (ARN) of the AWS log group(s). + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:*" + // Note: See the [log group ARN format documentation]. + // + // [log group ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format + AWSLogGroupARNsKey = attribute.Key("aws.log.group.arns") + + // AWSLogGroupNamesKey is the attribute Key conforming to the + // "aws.log.group.names" semantic conventions. It represents the name(s) of the + // AWS log group(s) an application is writing to. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/aws/lambda/my-function", "opentelemetry-service" + // Note: Multiple log groups must be supported for cases like multi-container + // applications, where a single application has sidecar containers, and each + // write to their own log group. + AWSLogGroupNamesKey = attribute.Key("aws.log.group.names") + + // AWSLogStreamARNsKey is the attribute Key conforming to the + // "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the + // AWS log stream(s). + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:log-stream:logs/main/10838bed-421f-43ef-870a-f43feacbbb5b" + // Note: See the [log stream ARN format documentation]. One log group can + // contain several log streams, so these ARNs necessarily identify both a log + // group and a log stream. + // + // [log stream ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format + AWSLogStreamARNsKey = attribute.Key("aws.log.stream.arns") + + // AWSLogStreamNamesKey is the attribute Key conforming to the + // "aws.log.stream.names" semantic conventions. It represents the name(s) of the + // AWS log stream(s) an application is writing to. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "logs/main/10838bed-421f-43ef-870a-f43feacbbb5b" + AWSLogStreamNamesKey = attribute.Key("aws.log.stream.names") + + // AWSRequestIDKey is the attribute Key conforming to the "aws.request_id" + // semantic conventions. It represents the AWS request ID as returned in the + // response headers `x-amzn-requestid`, `x-amzn-request-id` or + // `x-amz-request-id`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "79b9da39-b7ae-508a-a6bc-864b2829c622", "C9ER4AJX75574TDJ" + AWSRequestIDKey = attribute.Key("aws.request_id") + + // AWSS3BucketKey is the attribute Key conforming to the "aws.s3.bucket" + // semantic conventions. It represents the S3 bucket name the request refers to. + // Corresponds to the `--bucket` parameter of the [S3 API] operations. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "some-bucket-name" + // Note: The `bucket` attribute is applicable to all S3 operations that + // reference a bucket, i.e. that require the bucket name as a mandatory + // parameter. + // This applies to almost all S3 operations except `list-buckets`. + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + AWSS3BucketKey = attribute.Key("aws.s3.bucket") + + // AWSS3CopySourceKey is the attribute Key conforming to the + // "aws.s3.copy_source" semantic conventions. It represents the source object + // (in the form `bucket`/`key`) for the copy operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "someFile.yml" + // Note: The `copy_source` attribute applies to S3 copy operations and + // corresponds to the `--copy-source` parameter + // of the [copy-object operation within the S3 API]. + // This applies in particular to the following operations: + // + // - [copy-object] + // - [upload-part-copy] + // + // + // [copy-object operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3CopySourceKey = attribute.Key("aws.s3.copy_source") + + // AWSS3DeleteKey is the attribute Key conforming to the "aws.s3.delete" + // semantic conventions. It represents the delete request container that + // specifies the objects to be deleted. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "Objects=[{Key=string,VersionId=string},{Key=string,VersionId=string}],Quiet=boolean" + // Note: The `delete` attribute is only applicable to the [delete-object] + // operation. + // The `delete` attribute corresponds to the `--delete` parameter of the + // [delete-objects operation within the S3 API]. + // + // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html + // [delete-objects operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-objects.html + AWSS3DeleteKey = attribute.Key("aws.s3.delete") + + // AWSS3KeyKey is the attribute Key conforming to the "aws.s3.key" semantic + // conventions. It represents the S3 object key the request refers to. + // Corresponds to the `--key` parameter of the [S3 API] operations. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "someFile.yml" + // Note: The `key` attribute is applicable to all object-related S3 operations, + // i.e. that require the object key as a mandatory parameter. + // This applies in particular to the following operations: + // + // - [copy-object] + // - [delete-object] + // - [get-object] + // - [head-object] + // - [put-object] + // - [restore-object] + // - [select-object-content] + // - [abort-multipart-upload] + // - [complete-multipart-upload] + // - [create-multipart-upload] + // - [list-parts] + // - [upload-part] + // - [upload-part-copy] + // + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html + // [get-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/get-object.html + // [head-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/head-object.html + // [put-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/put-object.html + // [restore-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/restore-object.html + // [select-object-content]: https://docs.aws.amazon.com/cli/latest/reference/s3api/select-object-content.html + // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html + // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html + // [create-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/create-multipart-upload.html + // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3KeyKey = attribute.Key("aws.s3.key") + + // AWSS3PartNumberKey is the attribute Key conforming to the + // "aws.s3.part_number" semantic conventions. It represents the part number of + // the part being uploaded in a multipart-upload operation. This is a positive + // integer between 1 and 10,000. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3456 + // Note: The `part_number` attribute is only applicable to the [upload-part] + // and [upload-part-copy] operations. + // The `part_number` attribute corresponds to the `--part-number` parameter of + // the + // [upload-part operation within the S3 API]. + // + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + // [upload-part operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + AWSS3PartNumberKey = attribute.Key("aws.s3.part_number") + + // AWSS3UploadIDKey is the attribute Key conforming to the "aws.s3.upload_id" + // semantic conventions. It represents the upload ID that identifies the + // multipart upload. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "dfRtDYWFbkRONycy.Yxwh66Yjlx.cph0gtNBtJ" + // Note: The `upload_id` attribute applies to S3 multipart-upload operations and + // corresponds to the `--upload-id` parameter + // of the [S3 API] multipart operations. + // This applies in particular to the following operations: + // + // - [abort-multipart-upload] + // - [complete-multipart-upload] + // - [list-parts] + // - [upload-part] + // - [upload-part-copy] + // + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html + // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html + // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3UploadIDKey = attribute.Key("aws.s3.upload_id") + + // AWSSecretsmanagerSecretARNKey is the attribute Key conforming to the + // "aws.secretsmanager.secret.arn" semantic conventions. It represents the ARN + // of the Secret stored in the Secrets Mangger. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:secretsmanager:us-east-1:123456789012:secret:SecretName-6RandomCharacters" + AWSSecretsmanagerSecretARNKey = attribute.Key("aws.secretsmanager.secret.arn") + + // AWSSNSTopicARNKey is the attribute Key conforming to the "aws.sns.topic.arn" + // semantic conventions. It represents the ARN of the AWS SNS Topic. An Amazon + // SNS [topic] is a logical access point that acts as a communication channel. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:sns:us-east-1:123456789012:mystack-mytopic-NZJ5JSMVGFIE" + // + // [topic]: https://docs.aws.amazon.com/sns/latest/dg/sns-create-topic.html + AWSSNSTopicARNKey = attribute.Key("aws.sns.topic.arn") + + // AWSSQSQueueURLKey is the attribute Key conforming to the "aws.sqs.queue.url" + // semantic conventions. It represents the URL of the AWS SQS Queue. It's a + // unique identifier for a queue in Amazon Simple Queue Service (SQS) and is + // used to access the queue and perform actions on it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://sqs.us-east-1.amazonaws.com/123456789012/MyQueue" + AWSSQSQueueURLKey = attribute.Key("aws.sqs.queue.url") + + // AWSStepFunctionsActivityARNKey is the attribute Key conforming to the + // "aws.step_functions.activity.arn" semantic conventions. It represents the ARN + // of the AWS Step Functions Activity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:states:us-east-1:123456789012:activity:get-greeting" + AWSStepFunctionsActivityARNKey = attribute.Key("aws.step_functions.activity.arn") + + // AWSStepFunctionsStateMachineARNKey is the attribute Key conforming to the + // "aws.step_functions.state_machine.arn" semantic conventions. It represents + // the ARN of the AWS Step Functions State Machine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:states:us-east-1:123456789012:stateMachine:myStateMachine:1" + AWSStepFunctionsStateMachineARNKey = attribute.Key("aws.step_functions.state_machine.arn") +) + +// AWSBedrockGuardrailID returns an attribute KeyValue conforming to the +// "aws.bedrock.guardrail.id" semantic conventions. It represents the unique +// identifier of the AWS Bedrock Guardrail. A [guardrail] helps safeguard and +// prevent unwanted behavior from model responses or user messages. +// +// [guardrail]: https://docs.aws.amazon.com/bedrock/latest/userguide/guardrails.html +func AWSBedrockGuardrailID(val string) attribute.KeyValue { + return AWSBedrockGuardrailIDKey.String(val) +} + +// AWSBedrockKnowledgeBaseID returns an attribute KeyValue conforming to the +// "aws.bedrock.knowledge_base.id" semantic conventions. It represents the unique +// identifier of the AWS Bedrock Knowledge base. A [knowledge base] is a bank of +// information that can be queried by models to generate more relevant responses +// and augment prompts. +// +// [knowledge base]: https://docs.aws.amazon.com/bedrock/latest/userguide/knowledge-base.html +func AWSBedrockKnowledgeBaseID(val string) attribute.KeyValue { + return AWSBedrockKnowledgeBaseIDKey.String(val) +} + +// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming to +// the "aws.dynamodb.attribute_definitions" semantic conventions. It represents +// the JSON-serialized value of each item in the `AttributeDefinitions` request +// field. +func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue { + return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val) +} + +// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to the +// "aws.dynamodb.attributes_to_get" semantic conventions. It represents the value +// of the `AttributesToGet` request parameter. +func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue { + return AWSDynamoDBAttributesToGetKey.StringSlice(val) +} + +// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the +// "aws.dynamodb.consistent_read" semantic conventions. It represents the value +// of the `ConsistentRead` request parameter. +func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue { + return AWSDynamoDBConsistentReadKey.Bool(val) +} + +// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to the +// "aws.dynamodb.consumed_capacity" semantic conventions. It represents the +// JSON-serialized value of each item in the `ConsumedCapacity` response field. +func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue { + return AWSDynamoDBConsumedCapacityKey.StringSlice(val) +} + +// AWSDynamoDBCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.count" semantic conventions. It represents the value of the +// `Count` response parameter. +func AWSDynamoDBCount(val int) attribute.KeyValue { + return AWSDynamoDBCountKey.Int(val) +} + +// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming to the +// "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the +// value of the `ExclusiveStartTableName` request parameter. +func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue { + return AWSDynamoDBExclusiveStartTableKey.String(val) +} + +// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue +// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic +// conventions. It represents the JSON-serialized value of each item in the +// `GlobalSecondaryIndexUpdates` request field. +func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue { + return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val) +} + +// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue conforming to +// the "aws.dynamodb.global_secondary_indexes" semantic conventions. It +// represents the JSON-serialized value of each item of the +// `GlobalSecondaryIndexes` request field. +func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue { + return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val) +} + +// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the +// "aws.dynamodb.index_name" semantic conventions. It represents the value of the +// `IndexName` request parameter. +func AWSDynamoDBIndexName(val string) attribute.KeyValue { + return AWSDynamoDBIndexNameKey.String(val) +} + +// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming to +// the "aws.dynamodb.item_collection_metrics" semantic conventions. It represents +// the JSON-serialized value of the `ItemCollectionMetrics` response field. +func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue { + return AWSDynamoDBItemCollectionMetricsKey.String(val) +} + +// AWSDynamoDBLimit returns an attribute KeyValue conforming to the +// "aws.dynamodb.limit" semantic conventions. It represents the value of the +// `Limit` request parameter. +func AWSDynamoDBLimit(val int) attribute.KeyValue { + return AWSDynamoDBLimitKey.Int(val) +} + +// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming to +// the "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents +// the JSON-serialized value of each item of the `LocalSecondaryIndexes` request +// field. +func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue { + return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val) +} + +// AWSDynamoDBProjection returns an attribute KeyValue conforming to the +// "aws.dynamodb.projection" semantic conventions. It represents the value of the +// `ProjectionExpression` request parameter. +func AWSDynamoDBProjection(val string) attribute.KeyValue { + return AWSDynamoDBProjectionKey.String(val) +} + +// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue conforming to +// the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It +// represents the value of the `ProvisionedThroughput.ReadCapacityUnits` request +// parameter. +func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue { + return AWSDynamoDBProvisionedReadCapacityKey.Float64(val) +} + +// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue conforming +// to the "aws.dynamodb.provisioned_write_capacity" semantic conventions. It +// represents the value of the `ProvisionedThroughput.WriteCapacityUnits` request +// parameter. +func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue { + return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val) +} + +// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the +// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of +// the `ScanIndexForward` request parameter. +func AWSDynamoDBScanForward(val bool) attribute.KeyValue { + return AWSDynamoDBScanForwardKey.Bool(val) +} + +// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.scanned_count" semantic conventions. It represents the value of +// the `ScannedCount` response parameter. +func AWSDynamoDBScannedCount(val int) attribute.KeyValue { + return AWSDynamoDBScannedCountKey.Int(val) +} + +// AWSDynamoDBSegment returns an attribute KeyValue conforming to the +// "aws.dynamodb.segment" semantic conventions. It represents the value of the +// `Segment` request parameter. +func AWSDynamoDBSegment(val int) attribute.KeyValue { + return AWSDynamoDBSegmentKey.Int(val) +} + +// AWSDynamoDBSelect returns an attribute KeyValue conforming to the +// "aws.dynamodb.select" semantic conventions. It represents the value of the +// `Select` request parameter. +func AWSDynamoDBSelect(val string) attribute.KeyValue { + return AWSDynamoDBSelectKey.String(val) +} + +// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.table_count" semantic conventions. It represents the number of +// items in the `TableNames` response parameter. +func AWSDynamoDBTableCount(val int) attribute.KeyValue { + return AWSDynamoDBTableCountKey.Int(val) +} + +// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the +// "aws.dynamodb.table_names" semantic conventions. It represents the keys in the +// `RequestItems` object field. +func AWSDynamoDBTableNames(val ...string) attribute.KeyValue { + return AWSDynamoDBTableNamesKey.StringSlice(val) +} + +// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the +// "aws.dynamodb.total_segments" semantic conventions. It represents the value of +// the `TotalSegments` request parameter. +func AWSDynamoDBTotalSegments(val int) attribute.KeyValue { + return AWSDynamoDBTotalSegmentsKey.Int(val) +} + +// AWSECSClusterARN returns an attribute KeyValue conforming to the +// "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an +// [ECS cluster]. +// +// [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html +func AWSECSClusterARN(val string) attribute.KeyValue { + return AWSECSClusterARNKey.String(val) +} + +// AWSECSContainerARN returns an attribute KeyValue conforming to the +// "aws.ecs.container.arn" semantic conventions. It represents the Amazon +// Resource Name (ARN) of an [ECS container instance]. +// +// [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html +func AWSECSContainerARN(val string) attribute.KeyValue { + return AWSECSContainerARNKey.String(val) +} + +// AWSECSTaskARN returns an attribute KeyValue conforming to the +// "aws.ecs.task.arn" semantic conventions. It represents the ARN of a running +// [ECS task]. +// +// [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids +func AWSECSTaskARN(val string) attribute.KeyValue { + return AWSECSTaskARNKey.String(val) +} + +// AWSECSTaskFamily returns an attribute KeyValue conforming to the +// "aws.ecs.task.family" semantic conventions. It represents the family name of +// the [ECS task definition] used to create the ECS task. +// +// [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html +func AWSECSTaskFamily(val string) attribute.KeyValue { + return AWSECSTaskFamilyKey.String(val) +} + +// AWSECSTaskID returns an attribute KeyValue conforming to the "aws.ecs.task.id" +// semantic conventions. It represents the ID of a running ECS task. The ID MUST +// be extracted from `task.arn`. +func AWSECSTaskID(val string) attribute.KeyValue { + return AWSECSTaskIDKey.String(val) +} + +// AWSECSTaskRevision returns an attribute KeyValue conforming to the +// "aws.ecs.task.revision" semantic conventions. It represents the revision for +// the task definition used to create the ECS task. +func AWSECSTaskRevision(val string) attribute.KeyValue { + return AWSECSTaskRevisionKey.String(val) +} + +// AWSEKSClusterARN returns an attribute KeyValue conforming to the +// "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS +// cluster. +func AWSEKSClusterARN(val string) attribute.KeyValue { + return AWSEKSClusterARNKey.String(val) +} + +// AWSExtendedRequestID returns an attribute KeyValue conforming to the +// "aws.extended_request_id" semantic conventions. It represents the AWS extended +// request ID as returned in the response header `x-amz-id-2`. +func AWSExtendedRequestID(val string) attribute.KeyValue { + return AWSExtendedRequestIDKey.String(val) +} + +// AWSKinesisStreamName returns an attribute KeyValue conforming to the +// "aws.kinesis.stream_name" semantic conventions. It represents the name of the +// AWS Kinesis [stream] the request refers to. Corresponds to the `--stream-name` +// parameter of the Kinesis [describe-stream] operation. +// +// [stream]: https://docs.aws.amazon.com/streams/latest/dev/introduction.html +// [describe-stream]: https://docs.aws.amazon.com/cli/latest/reference/kinesis/describe-stream.html +func AWSKinesisStreamName(val string) attribute.KeyValue { + return AWSKinesisStreamNameKey.String(val) +} + +// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the +// "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked +// ARN as provided on the `Context` passed to the function ( +// `Lambda-Runtime-Invoked-Function-Arn` header on the `/runtime/invocation/next` +// applicable). +func AWSLambdaInvokedARN(val string) attribute.KeyValue { + return AWSLambdaInvokedARNKey.String(val) +} + +// AWSLambdaResourceMappingID returns an attribute KeyValue conforming to the +// "aws.lambda.resource_mapping.id" semantic conventions. It represents the UUID +// of the [AWS Lambda EvenSource Mapping]. An event source is mapped to a lambda +// function. It's contents are read by Lambda and used to trigger a function. +// This isn't available in the lambda execution context or the lambda runtime +// environtment. This is going to be populated by the AWS SDK for each language +// when that UUID is present. Some of these operations are +// Create/Delete/Get/List/Update EventSourceMapping. +// +// [AWS Lambda EvenSource Mapping]: https://docs.aws.amazon.com/AWSCloudFormation/latest/UserGuide/aws-resource-lambda-eventsourcemapping.html +func AWSLambdaResourceMappingID(val string) attribute.KeyValue { + return AWSLambdaResourceMappingIDKey.String(val) +} + +// AWSLogGroupARNs returns an attribute KeyValue conforming to the +// "aws.log.group.arns" semantic conventions. It represents the Amazon Resource +// Name(s) (ARN) of the AWS log group(s). +func AWSLogGroupARNs(val ...string) attribute.KeyValue { + return AWSLogGroupARNsKey.StringSlice(val) +} + +// AWSLogGroupNames returns an attribute KeyValue conforming to the +// "aws.log.group.names" semantic conventions. It represents the name(s) of the +// AWS log group(s) an application is writing to. +func AWSLogGroupNames(val ...string) attribute.KeyValue { + return AWSLogGroupNamesKey.StringSlice(val) +} + +// AWSLogStreamARNs returns an attribute KeyValue conforming to the +// "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the +// AWS log stream(s). +func AWSLogStreamARNs(val ...string) attribute.KeyValue { + return AWSLogStreamARNsKey.StringSlice(val) +} + +// AWSLogStreamNames returns an attribute KeyValue conforming to the +// "aws.log.stream.names" semantic conventions. It represents the name(s) of the +// AWS log stream(s) an application is writing to. +func AWSLogStreamNames(val ...string) attribute.KeyValue { + return AWSLogStreamNamesKey.StringSlice(val) +} + +// AWSRequestID returns an attribute KeyValue conforming to the "aws.request_id" +// semantic conventions. It represents the AWS request ID as returned in the +// response headers `x-amzn-requestid`, `x-amzn-request-id` or `x-amz-request-id` +// . +func AWSRequestID(val string) attribute.KeyValue { + return AWSRequestIDKey.String(val) +} + +// AWSS3Bucket returns an attribute KeyValue conforming to the "aws.s3.bucket" +// semantic conventions. It represents the S3 bucket name the request refers to. +// Corresponds to the `--bucket` parameter of the [S3 API] operations. +// +// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html +func AWSS3Bucket(val string) attribute.KeyValue { + return AWSS3BucketKey.String(val) +} + +// AWSS3CopySource returns an attribute KeyValue conforming to the +// "aws.s3.copy_source" semantic conventions. It represents the source object (in +// the form `bucket`/`key`) for the copy operation. +func AWSS3CopySource(val string) attribute.KeyValue { + return AWSS3CopySourceKey.String(val) +} + +// AWSS3Delete returns an attribute KeyValue conforming to the "aws.s3.delete" +// semantic conventions. It represents the delete request container that +// specifies the objects to be deleted. +func AWSS3Delete(val string) attribute.KeyValue { + return AWSS3DeleteKey.String(val) +} + +// AWSS3Key returns an attribute KeyValue conforming to the "aws.s3.key" semantic +// conventions. It represents the S3 object key the request refers to. +// Corresponds to the `--key` parameter of the [S3 API] operations. +// +// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html +func AWSS3Key(val string) attribute.KeyValue { + return AWSS3KeyKey.String(val) +} + +// AWSS3PartNumber returns an attribute KeyValue conforming to the +// "aws.s3.part_number" semantic conventions. It represents the part number of +// the part being uploaded in a multipart-upload operation. This is a positive +// integer between 1 and 10,000. +func AWSS3PartNumber(val int) attribute.KeyValue { + return AWSS3PartNumberKey.Int(val) +} + +// AWSS3UploadID returns an attribute KeyValue conforming to the +// "aws.s3.upload_id" semantic conventions. It represents the upload ID that +// identifies the multipart upload. +func AWSS3UploadID(val string) attribute.KeyValue { + return AWSS3UploadIDKey.String(val) +} + +// AWSSecretsmanagerSecretARN returns an attribute KeyValue conforming to the +// "aws.secretsmanager.secret.arn" semantic conventions. It represents the ARN of +// the Secret stored in the Secrets Mangger. +func AWSSecretsmanagerSecretARN(val string) attribute.KeyValue { + return AWSSecretsmanagerSecretARNKey.String(val) +} + +// AWSSNSTopicARN returns an attribute KeyValue conforming to the +// "aws.sns.topic.arn" semantic conventions. It represents the ARN of the AWS SNS +// Topic. An Amazon SNS [topic] is a logical access point that acts as a +// communication channel. +// +// [topic]: https://docs.aws.amazon.com/sns/latest/dg/sns-create-topic.html +func AWSSNSTopicARN(val string) attribute.KeyValue { + return AWSSNSTopicARNKey.String(val) +} + +// AWSSQSQueueURL returns an attribute KeyValue conforming to the +// "aws.sqs.queue.url" semantic conventions. It represents the URL of the AWS SQS +// Queue. It's a unique identifier for a queue in Amazon Simple Queue Service +// (SQS) and is used to access the queue and perform actions on it. +func AWSSQSQueueURL(val string) attribute.KeyValue { + return AWSSQSQueueURLKey.String(val) +} + +// AWSStepFunctionsActivityARN returns an attribute KeyValue conforming to the +// "aws.step_functions.activity.arn" semantic conventions. It represents the ARN +// of the AWS Step Functions Activity. +func AWSStepFunctionsActivityARN(val string) attribute.KeyValue { + return AWSStepFunctionsActivityARNKey.String(val) +} + +// AWSStepFunctionsStateMachineARN returns an attribute KeyValue conforming to +// the "aws.step_functions.state_machine.arn" semantic conventions. It represents +// the ARN of the AWS Step Functions State Machine. +func AWSStepFunctionsStateMachineARN(val string) attribute.KeyValue { + return AWSStepFunctionsStateMachineARNKey.String(val) +} + +// Enum values for aws.ecs.launchtype +var ( + // ec2 + // Stability: development + AWSECSLaunchtypeEC2 = AWSECSLaunchtypeKey.String("ec2") + // fargate + // Stability: development + AWSECSLaunchtypeFargate = AWSECSLaunchtypeKey.String("fargate") +) + +// Namespace: az +const ( + // AzNamespaceKey is the attribute Key conforming to the "az.namespace" semantic + // conventions. It represents the [Azure Resource Provider Namespace] as + // recognized by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Microsoft.Storage", "Microsoft.KeyVault", "Microsoft.ServiceBus" + // + // [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers + AzNamespaceKey = attribute.Key("az.namespace") + + // AzServiceRequestIDKey is the attribute Key conforming to the + // "az.service_request_id" semantic conventions. It represents the unique + // identifier of the service request. It's generated by the Azure service and + // returned with the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "00000000-0000-0000-0000-000000000000" + AzServiceRequestIDKey = attribute.Key("az.service_request_id") +) + +// AzNamespace returns an attribute KeyValue conforming to the "az.namespace" +// semantic conventions. It represents the [Azure Resource Provider Namespace] as +// recognized by the client. +// +// [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers +func AzNamespace(val string) attribute.KeyValue { + return AzNamespaceKey.String(val) +} + +// AzServiceRequestID returns an attribute KeyValue conforming to the +// "az.service_request_id" semantic conventions. It represents the unique +// identifier of the service request. It's generated by the Azure service and +// returned with the response. +func AzServiceRequestID(val string) attribute.KeyValue { + return AzServiceRequestIDKey.String(val) +} + +// Namespace: azure +const ( + // AzureClientIDKey is the attribute Key conforming to the "azure.client.id" + // semantic conventions. It represents the unique identifier of the client + // instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "3ba4827d-4422-483f-b59f-85b74211c11d", "storage-client-1" + AzureClientIDKey = attribute.Key("azure.client.id") + + // AzureCosmosDBConnectionModeKey is the attribute Key conforming to the + // "azure.cosmosdb.connection.mode" semantic conventions. It represents the + // cosmos client connection mode. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AzureCosmosDBConnectionModeKey = attribute.Key("azure.cosmosdb.connection.mode") + + // AzureCosmosDBConsistencyLevelKey is the attribute Key conforming to the + // "azure.cosmosdb.consistency.level" semantic conventions. It represents the + // account or request [consistency level]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Eventual", "ConsistentPrefix", "BoundedStaleness", "Strong", + // "Session" + // + // [consistency level]: https://learn.microsoft.com/azure/cosmos-db/consistency-levels + AzureCosmosDBConsistencyLevelKey = attribute.Key("azure.cosmosdb.consistency.level") + + // AzureCosmosDBOperationContactedRegionsKey is the attribute Key conforming to + // the "azure.cosmosdb.operation.contacted_regions" semantic conventions. It + // represents the list of regions contacted during operation in the order that + // they were contacted. If there is more than one region listed, it indicates + // that the operation was performed on multiple regions i.e. cross-regional + // call. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "North Central US", "Australia East", "Australia Southeast" + // Note: Region name matches the format of `displayName` in [Azure Location API] + // + // [Azure Location API]: https://learn.microsoft.com/rest/api/subscription/subscriptions/list-locations?view=rest-subscription-2021-10-01&tabs=HTTP#location + AzureCosmosDBOperationContactedRegionsKey = attribute.Key("azure.cosmosdb.operation.contacted_regions") + + // AzureCosmosDBOperationRequestChargeKey is the attribute Key conforming to the + // "azure.cosmosdb.operation.request_charge" semantic conventions. It represents + // the number of request units consumed by the operation. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 46.18, 1.0 + AzureCosmosDBOperationRequestChargeKey = attribute.Key("azure.cosmosdb.operation.request_charge") + + // AzureCosmosDBRequestBodySizeKey is the attribute Key conforming to the + // "azure.cosmosdb.request.body.size" semantic conventions. It represents the + // request payload size in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AzureCosmosDBRequestBodySizeKey = attribute.Key("azure.cosmosdb.request.body.size") + + // AzureCosmosDBResponseSubStatusCodeKey is the attribute Key conforming to the + // "azure.cosmosdb.response.sub_status_code" semantic conventions. It represents + // the cosmos DB sub status code. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1000, 1002 + AzureCosmosDBResponseSubStatusCodeKey = attribute.Key("azure.cosmosdb.response.sub_status_code") +) + +// AzureClientID returns an attribute KeyValue conforming to the +// "azure.client.id" semantic conventions. It represents the unique identifier of +// the client instance. +func AzureClientID(val string) attribute.KeyValue { + return AzureClientIDKey.String(val) +} + +// AzureCosmosDBOperationContactedRegions returns an attribute KeyValue +// conforming to the "azure.cosmosdb.operation.contacted_regions" semantic +// conventions. It represents the list of regions contacted during operation in +// the order that they were contacted. If there is more than one region listed, +// it indicates that the operation was performed on multiple regions i.e. +// cross-regional call. +func AzureCosmosDBOperationContactedRegions(val ...string) attribute.KeyValue { + return AzureCosmosDBOperationContactedRegionsKey.StringSlice(val) +} + +// AzureCosmosDBOperationRequestCharge returns an attribute KeyValue conforming +// to the "azure.cosmosdb.operation.request_charge" semantic conventions. It +// represents the number of request units consumed by the operation. +func AzureCosmosDBOperationRequestCharge(val float64) attribute.KeyValue { + return AzureCosmosDBOperationRequestChargeKey.Float64(val) +} + +// AzureCosmosDBRequestBodySize returns an attribute KeyValue conforming to the +// "azure.cosmosdb.request.body.size" semantic conventions. It represents the +// request payload size in bytes. +func AzureCosmosDBRequestBodySize(val int) attribute.KeyValue { + return AzureCosmosDBRequestBodySizeKey.Int(val) +} + +// AzureCosmosDBResponseSubStatusCode returns an attribute KeyValue conforming to +// the "azure.cosmosdb.response.sub_status_code" semantic conventions. It +// represents the cosmos DB sub status code. +func AzureCosmosDBResponseSubStatusCode(val int) attribute.KeyValue { + return AzureCosmosDBResponseSubStatusCodeKey.Int(val) +} + +// Enum values for azure.cosmosdb.connection.mode +var ( + // Gateway (HTTP) connection. + // Stability: development + AzureCosmosDBConnectionModeGateway = AzureCosmosDBConnectionModeKey.String("gateway") + // Direct connection. + // Stability: development + AzureCosmosDBConnectionModeDirect = AzureCosmosDBConnectionModeKey.String("direct") +) + +// Enum values for azure.cosmosdb.consistency.level +var ( + // strong + // Stability: development + AzureCosmosDBConsistencyLevelStrong = AzureCosmosDBConsistencyLevelKey.String("Strong") + // bounded_staleness + // Stability: development + AzureCosmosDBConsistencyLevelBoundedStaleness = AzureCosmosDBConsistencyLevelKey.String("BoundedStaleness") + // session + // Stability: development + AzureCosmosDBConsistencyLevelSession = AzureCosmosDBConsistencyLevelKey.String("Session") + // eventual + // Stability: development + AzureCosmosDBConsistencyLevelEventual = AzureCosmosDBConsistencyLevelKey.String("Eventual") + // consistent_prefix + // Stability: development + AzureCosmosDBConsistencyLevelConsistentPrefix = AzureCosmosDBConsistencyLevelKey.String("ConsistentPrefix") +) + +// Namespace: browser +const ( + // BrowserBrandsKey is the attribute Key conforming to the "browser.brands" + // semantic conventions. It represents the array of brand name and version + // separated by a space. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: " Not A;Brand 99", "Chromium 99", "Chrome 99" + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.brands`). + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + BrowserBrandsKey = attribute.Key("browser.brands") + + // BrowserLanguageKey is the attribute Key conforming to the "browser.language" + // semantic conventions. It represents the preferred language of the user using + // the browser. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "en", "en-US", "fr", "fr-FR" + // Note: This value is intended to be taken from the Navigator API + // `navigator.language`. + BrowserLanguageKey = attribute.Key("browser.language") + + // BrowserMobileKey is the attribute Key conforming to the "browser.mobile" + // semantic conventions. It represents a boolean that is true if the browser is + // running on a mobile device. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.mobile`). If unavailable, this attribute SHOULD be + // left unset. + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + BrowserMobileKey = attribute.Key("browser.mobile") + + // BrowserPlatformKey is the attribute Key conforming to the "browser.platform" + // semantic conventions. It represents the platform on which the browser is + // running. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Windows", "macOS", "Android" + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.platform`). If unavailable, the legacy + // `navigator.platform` API SHOULD NOT be used instead and this attribute SHOULD + // be left unset in order for the values to be consistent. + // The list of possible values is defined in the + // [W3C User-Agent Client Hints specification]. Note that some (but not all) of + // these values can overlap with values in the + // [`os.type` and `os.name` attributes]. However, for consistency, the values in + // the `browser.platform` attribute should capture the exact value that the user + // agent provides. + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + // [W3C User-Agent Client Hints specification]: https://wicg.github.io/ua-client-hints/#sec-ch-ua-platform + // [`os.type` and `os.name` attributes]: ./os.md + BrowserPlatformKey = attribute.Key("browser.platform") +) + +// BrowserBrands returns an attribute KeyValue conforming to the "browser.brands" +// semantic conventions. It represents the array of brand name and version +// separated by a space. +func BrowserBrands(val ...string) attribute.KeyValue { + return BrowserBrandsKey.StringSlice(val) +} + +// BrowserLanguage returns an attribute KeyValue conforming to the +// "browser.language" semantic conventions. It represents the preferred language +// of the user using the browser. +func BrowserLanguage(val string) attribute.KeyValue { + return BrowserLanguageKey.String(val) +} + +// BrowserMobile returns an attribute KeyValue conforming to the "browser.mobile" +// semantic conventions. It represents a boolean that is true if the browser is +// running on a mobile device. +func BrowserMobile(val bool) attribute.KeyValue { + return BrowserMobileKey.Bool(val) +} + +// BrowserPlatform returns an attribute KeyValue conforming to the +// "browser.platform" semantic conventions. It represents the platform on which +// the browser is running. +func BrowserPlatform(val string) attribute.KeyValue { + return BrowserPlatformKey.String(val) +} + +// Namespace: cassandra +const ( + // CassandraConsistencyLevelKey is the attribute Key conforming to the + // "cassandra.consistency.level" semantic conventions. It represents the + // consistency level of the query. Based on consistency values from [CQL]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [CQL]: https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html + CassandraConsistencyLevelKey = attribute.Key("cassandra.consistency.level") + + // CassandraCoordinatorDCKey is the attribute Key conforming to the + // "cassandra.coordinator.dc" semantic conventions. It represents the data + // center of the coordinating node for a query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: us-west-2 + CassandraCoordinatorDCKey = attribute.Key("cassandra.coordinator.dc") + + // CassandraCoordinatorIDKey is the attribute Key conforming to the + // "cassandra.coordinator.id" semantic conventions. It represents the ID of the + // coordinating node for a query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: be13faa2-8574-4d71-926d-27f16cf8a7af + CassandraCoordinatorIDKey = attribute.Key("cassandra.coordinator.id") + + // CassandraPageSizeKey is the attribute Key conforming to the + // "cassandra.page.size" semantic conventions. It represents the fetch size used + // for paging, i.e. how many rows will be returned at once. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 5000 + CassandraPageSizeKey = attribute.Key("cassandra.page.size") + + // CassandraQueryIdempotentKey is the attribute Key conforming to the + // "cassandra.query.idempotent" semantic conventions. It represents the whether + // or not the query is idempotent. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + CassandraQueryIdempotentKey = attribute.Key("cassandra.query.idempotent") + + // CassandraSpeculativeExecutionCountKey is the attribute Key conforming to the + // "cassandra.speculative_execution.count" semantic conventions. It represents + // the number of times a query was speculatively executed. Not set or `0` if the + // query was not executed speculatively. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 2 + CassandraSpeculativeExecutionCountKey = attribute.Key("cassandra.speculative_execution.count") +) + +// CassandraCoordinatorDC returns an attribute KeyValue conforming to the +// "cassandra.coordinator.dc" semantic conventions. It represents the data center +// of the coordinating node for a query. +func CassandraCoordinatorDC(val string) attribute.KeyValue { + return CassandraCoordinatorDCKey.String(val) +} + +// CassandraCoordinatorID returns an attribute KeyValue conforming to the +// "cassandra.coordinator.id" semantic conventions. It represents the ID of the +// coordinating node for a query. +func CassandraCoordinatorID(val string) attribute.KeyValue { + return CassandraCoordinatorIDKey.String(val) +} + +// CassandraPageSize returns an attribute KeyValue conforming to the +// "cassandra.page.size" semantic conventions. It represents the fetch size used +// for paging, i.e. how many rows will be returned at once. +func CassandraPageSize(val int) attribute.KeyValue { + return CassandraPageSizeKey.Int(val) +} + +// CassandraQueryIdempotent returns an attribute KeyValue conforming to the +// "cassandra.query.idempotent" semantic conventions. It represents the whether +// or not the query is idempotent. +func CassandraQueryIdempotent(val bool) attribute.KeyValue { + return CassandraQueryIdempotentKey.Bool(val) +} + +// CassandraSpeculativeExecutionCount returns an attribute KeyValue conforming to +// the "cassandra.speculative_execution.count" semantic conventions. It +// represents the number of times a query was speculatively executed. Not set or +// `0` if the query was not executed speculatively. +func CassandraSpeculativeExecutionCount(val int) attribute.KeyValue { + return CassandraSpeculativeExecutionCountKey.Int(val) +} + +// Enum values for cassandra.consistency.level +var ( + // all + // Stability: development + CassandraConsistencyLevelAll = CassandraConsistencyLevelKey.String("all") + // each_quorum + // Stability: development + CassandraConsistencyLevelEachQuorum = CassandraConsistencyLevelKey.String("each_quorum") + // quorum + // Stability: development + CassandraConsistencyLevelQuorum = CassandraConsistencyLevelKey.String("quorum") + // local_quorum + // Stability: development + CassandraConsistencyLevelLocalQuorum = CassandraConsistencyLevelKey.String("local_quorum") + // one + // Stability: development + CassandraConsistencyLevelOne = CassandraConsistencyLevelKey.String("one") + // two + // Stability: development + CassandraConsistencyLevelTwo = CassandraConsistencyLevelKey.String("two") + // three + // Stability: development + CassandraConsistencyLevelThree = CassandraConsistencyLevelKey.String("three") + // local_one + // Stability: development + CassandraConsistencyLevelLocalOne = CassandraConsistencyLevelKey.String("local_one") + // any + // Stability: development + CassandraConsistencyLevelAny = CassandraConsistencyLevelKey.String("any") + // serial + // Stability: development + CassandraConsistencyLevelSerial = CassandraConsistencyLevelKey.String("serial") + // local_serial + // Stability: development + CassandraConsistencyLevelLocalSerial = CassandraConsistencyLevelKey.String("local_serial") +) + +// Namespace: cicd +const ( + // CICDPipelineActionNameKey is the attribute Key conforming to the + // "cicd.pipeline.action.name" semantic conventions. It represents the kind of + // action a pipeline run is performing. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "BUILD", "RUN", "SYNC" + CICDPipelineActionNameKey = attribute.Key("cicd.pipeline.action.name") + + // CICDPipelineNameKey is the attribute Key conforming to the + // "cicd.pipeline.name" semantic conventions. It represents the human readable + // name of the pipeline within a CI/CD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Build and Test", "Lint", "Deploy Go Project", + // "deploy_to_environment" + CICDPipelineNameKey = attribute.Key("cicd.pipeline.name") + + // CICDPipelineResultKey is the attribute Key conforming to the + // "cicd.pipeline.result" semantic conventions. It represents the result of a + // pipeline run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "timeout", "skipped" + CICDPipelineResultKey = attribute.Key("cicd.pipeline.result") + + // CICDPipelineRunIDKey is the attribute Key conforming to the + // "cicd.pipeline.run.id" semantic conventions. It represents the unique + // identifier of a pipeline run within a CI/CD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "120912" + CICDPipelineRunIDKey = attribute.Key("cicd.pipeline.run.id") + + // CICDPipelineRunStateKey is the attribute Key conforming to the + // "cicd.pipeline.run.state" semantic conventions. It represents the pipeline + // run goes through these states during its lifecycle. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pending", "executing", "finalizing" + CICDPipelineRunStateKey = attribute.Key("cicd.pipeline.run.state") + + // CICDPipelineRunURLFullKey is the attribute Key conforming to the + // "cicd.pipeline.run.url.full" semantic conventions. It represents the [URL] of + // the pipeline run, providing the complete address in order to locate and + // identify the pipeline run. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763?pr=1075" + // + // [URL]: https://wikipedia.org/wiki/URL + CICDPipelineRunURLFullKey = attribute.Key("cicd.pipeline.run.url.full") + + // CICDPipelineTaskNameKey is the attribute Key conforming to the + // "cicd.pipeline.task.name" semantic conventions. It represents the human + // readable name of a task within a pipeline. Task here most closely aligns with + // a [computing process] in a pipeline. Other terms for tasks include commands, + // steps, and procedures. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Run GoLang Linter", "Go Build", "go-test", "deploy_binary" + // + // [computing process]: https://wikipedia.org/wiki/Pipeline_(computing) + CICDPipelineTaskNameKey = attribute.Key("cicd.pipeline.task.name") + + // CICDPipelineTaskRunIDKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.id" semantic conventions. It represents the unique + // identifier of a task run within a pipeline. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "12097" + CICDPipelineTaskRunIDKey = attribute.Key("cicd.pipeline.task.run.id") + + // CICDPipelineTaskRunResultKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.result" semantic conventions. It represents the + // result of a task run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "timeout", "skipped" + CICDPipelineTaskRunResultKey = attribute.Key("cicd.pipeline.task.run.result") + + // CICDPipelineTaskRunURLFullKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.url.full" semantic conventions. It represents the + // [URL] of the pipeline task run, providing the complete address in order to + // locate and identify the pipeline task run. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763/job/26920038674?pr=1075" + // + // [URL]: https://wikipedia.org/wiki/URL + CICDPipelineTaskRunURLFullKey = attribute.Key("cicd.pipeline.task.run.url.full") + + // CICDPipelineTaskTypeKey is the attribute Key conforming to the + // "cicd.pipeline.task.type" semantic conventions. It represents the type of the + // task within a pipeline. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "build", "test", "deploy" + CICDPipelineTaskTypeKey = attribute.Key("cicd.pipeline.task.type") + + // CICDSystemComponentKey is the attribute Key conforming to the + // "cicd.system.component" semantic conventions. It represents the name of a + // component of the CICD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "controller", "scheduler", "agent" + CICDSystemComponentKey = attribute.Key("cicd.system.component") + + // CICDWorkerIDKey is the attribute Key conforming to the "cicd.worker.id" + // semantic conventions. It represents the unique identifier of a worker within + // a CICD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "abc123", "10.0.1.2", "controller" + CICDWorkerIDKey = attribute.Key("cicd.worker.id") + + // CICDWorkerNameKey is the attribute Key conforming to the "cicd.worker.name" + // semantic conventions. It represents the name of a worker within a CICD + // system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "agent-abc", "controller", "Ubuntu LTS" + CICDWorkerNameKey = attribute.Key("cicd.worker.name") + + // CICDWorkerStateKey is the attribute Key conforming to the "cicd.worker.state" + // semantic conventions. It represents the state of a CICD worker / agent. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "idle", "busy", "down" + CICDWorkerStateKey = attribute.Key("cicd.worker.state") + + // CICDWorkerURLFullKey is the attribute Key conforming to the + // "cicd.worker.url.full" semantic conventions. It represents the [URL] of the + // worker, providing the complete address in order to locate and identify the + // worker. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://cicd.example.org/worker/abc123" + // + // [URL]: https://wikipedia.org/wiki/URL + CICDWorkerURLFullKey = attribute.Key("cicd.worker.url.full") +) + +// CICDPipelineName returns an attribute KeyValue conforming to the +// "cicd.pipeline.name" semantic conventions. It represents the human readable +// name of the pipeline within a CI/CD system. +func CICDPipelineName(val string) attribute.KeyValue { + return CICDPipelineNameKey.String(val) +} + +// CICDPipelineRunID returns an attribute KeyValue conforming to the +// "cicd.pipeline.run.id" semantic conventions. It represents the unique +// identifier of a pipeline run within a CI/CD system. +func CICDPipelineRunID(val string) attribute.KeyValue { + return CICDPipelineRunIDKey.String(val) +} + +// CICDPipelineRunURLFull returns an attribute KeyValue conforming to the +// "cicd.pipeline.run.url.full" semantic conventions. It represents the [URL] of +// the pipeline run, providing the complete address in order to locate and +// identify the pipeline run. +// +// [URL]: https://wikipedia.org/wiki/URL +func CICDPipelineRunURLFull(val string) attribute.KeyValue { + return CICDPipelineRunURLFullKey.String(val) +} + +// CICDPipelineTaskName returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.name" semantic conventions. It represents the human +// readable name of a task within a pipeline. Task here most closely aligns with +// a [computing process] in a pipeline. Other terms for tasks include commands, +// steps, and procedures. +// +// [computing process]: https://wikipedia.org/wiki/Pipeline_(computing) +func CICDPipelineTaskName(val string) attribute.KeyValue { + return CICDPipelineTaskNameKey.String(val) +} + +// CICDPipelineTaskRunID returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.run.id" semantic conventions. It represents the unique +// identifier of a task run within a pipeline. +func CICDPipelineTaskRunID(val string) attribute.KeyValue { + return CICDPipelineTaskRunIDKey.String(val) +} + +// CICDPipelineTaskRunURLFull returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.run.url.full" semantic conventions. It represents the +// [URL] of the pipeline task run, providing the complete address in order to +// locate and identify the pipeline task run. +// +// [URL]: https://wikipedia.org/wiki/URL +func CICDPipelineTaskRunURLFull(val string) attribute.KeyValue { + return CICDPipelineTaskRunURLFullKey.String(val) +} + +// CICDSystemComponent returns an attribute KeyValue conforming to the +// "cicd.system.component" semantic conventions. It represents the name of a +// component of the CICD system. +func CICDSystemComponent(val string) attribute.KeyValue { + return CICDSystemComponentKey.String(val) +} + +// CICDWorkerID returns an attribute KeyValue conforming to the "cicd.worker.id" +// semantic conventions. It represents the unique identifier of a worker within a +// CICD system. +func CICDWorkerID(val string) attribute.KeyValue { + return CICDWorkerIDKey.String(val) +} + +// CICDWorkerName returns an attribute KeyValue conforming to the +// "cicd.worker.name" semantic conventions. It represents the name of a worker +// within a CICD system. +func CICDWorkerName(val string) attribute.KeyValue { + return CICDWorkerNameKey.String(val) +} + +// CICDWorkerURLFull returns an attribute KeyValue conforming to the +// "cicd.worker.url.full" semantic conventions. It represents the [URL] of the +// worker, providing the complete address in order to locate and identify the +// worker. +// +// [URL]: https://wikipedia.org/wiki/URL +func CICDWorkerURLFull(val string) attribute.KeyValue { + return CICDWorkerURLFullKey.String(val) +} + +// Enum values for cicd.pipeline.action.name +var ( + // The pipeline run is executing a build. + // Stability: development + CICDPipelineActionNameBuild = CICDPipelineActionNameKey.String("BUILD") + // The pipeline run is executing. + // Stability: development + CICDPipelineActionNameRun = CICDPipelineActionNameKey.String("RUN") + // The pipeline run is executing a sync. + // Stability: development + CICDPipelineActionNameSync = CICDPipelineActionNameKey.String("SYNC") +) + +// Enum values for cicd.pipeline.result +var ( + // The pipeline run finished successfully. + // Stability: development + CICDPipelineResultSuccess = CICDPipelineResultKey.String("success") + // The pipeline run did not finish successfully, eg. due to a compile error or a + // failing test. Such failures are usually detected by non-zero exit codes of + // the tools executed in the pipeline run. + // Stability: development + CICDPipelineResultFailure = CICDPipelineResultKey.String("failure") + // The pipeline run failed due to an error in the CICD system, eg. due to the + // worker being killed. + // Stability: development + CICDPipelineResultError = CICDPipelineResultKey.String("error") + // A timeout caused the pipeline run to be interrupted. + // Stability: development + CICDPipelineResultTimeout = CICDPipelineResultKey.String("timeout") + // The pipeline run was cancelled, eg. by a user manually cancelling the + // pipeline run. + // Stability: development + CICDPipelineResultCancellation = CICDPipelineResultKey.String("cancellation") + // The pipeline run was skipped, eg. due to a precondition not being met. + // Stability: development + CICDPipelineResultSkip = CICDPipelineResultKey.String("skip") +) + +// Enum values for cicd.pipeline.run.state +var ( + // The run pending state spans from the event triggering the pipeline run until + // the execution of the run starts (eg. time spent in a queue, provisioning + // agents, creating run resources). + // + // Stability: development + CICDPipelineRunStatePending = CICDPipelineRunStateKey.String("pending") + // The executing state spans the execution of any run tasks (eg. build, test). + // Stability: development + CICDPipelineRunStateExecuting = CICDPipelineRunStateKey.String("executing") + // The finalizing state spans from when the run has finished executing (eg. + // cleanup of run resources). + // Stability: development + CICDPipelineRunStateFinalizing = CICDPipelineRunStateKey.String("finalizing") +) + +// Enum values for cicd.pipeline.task.run.result +var ( + // The task run finished successfully. + // Stability: development + CICDPipelineTaskRunResultSuccess = CICDPipelineTaskRunResultKey.String("success") + // The task run did not finish successfully, eg. due to a compile error or a + // failing test. Such failures are usually detected by non-zero exit codes of + // the tools executed in the task run. + // Stability: development + CICDPipelineTaskRunResultFailure = CICDPipelineTaskRunResultKey.String("failure") + // The task run failed due to an error in the CICD system, eg. due to the worker + // being killed. + // Stability: development + CICDPipelineTaskRunResultError = CICDPipelineTaskRunResultKey.String("error") + // A timeout caused the task run to be interrupted. + // Stability: development + CICDPipelineTaskRunResultTimeout = CICDPipelineTaskRunResultKey.String("timeout") + // The task run was cancelled, eg. by a user manually cancelling the task run. + // Stability: development + CICDPipelineTaskRunResultCancellation = CICDPipelineTaskRunResultKey.String("cancellation") + // The task run was skipped, eg. due to a precondition not being met. + // Stability: development + CICDPipelineTaskRunResultSkip = CICDPipelineTaskRunResultKey.String("skip") +) + +// Enum values for cicd.pipeline.task.type +var ( + // build + // Stability: development + CICDPipelineTaskTypeBuild = CICDPipelineTaskTypeKey.String("build") + // test + // Stability: development + CICDPipelineTaskTypeTest = CICDPipelineTaskTypeKey.String("test") + // deploy + // Stability: development + CICDPipelineTaskTypeDeploy = CICDPipelineTaskTypeKey.String("deploy") +) + +// Enum values for cicd.worker.state +var ( + // The worker is not performing work for the CICD system. It is available to the + // CICD system to perform work on (online / idle). + // Stability: development + CICDWorkerStateAvailable = CICDWorkerStateKey.String("available") + // The worker is performing work for the CICD system. + // Stability: development + CICDWorkerStateBusy = CICDWorkerStateKey.String("busy") + // The worker is not available to the CICD system (disconnected / down). + // Stability: development + CICDWorkerStateOffline = CICDWorkerStateKey.String("offline") +) + +// Namespace: client +const ( + // ClientAddressKey is the attribute Key conforming to the "client.address" + // semantic conventions. It represents the client address - domain name if + // available without reverse DNS lookup; otherwise, IP address or Unix domain + // socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "client.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the server side, and when communicating through an + // intermediary, `client.address` SHOULD represent the client address behind any + // intermediaries, for example proxies, if it's available. + ClientAddressKey = attribute.Key("client.address") + + // ClientPortKey is the attribute Key conforming to the "client.port" semantic + // conventions. It represents the client port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + // Note: When observed from the server side, and when communicating through an + // intermediary, `client.port` SHOULD represent the client port behind any + // intermediaries, for example proxies, if it's available. + ClientPortKey = attribute.Key("client.port") +) + +// ClientAddress returns an attribute KeyValue conforming to the "client.address" +// semantic conventions. It represents the client address - domain name if +// available without reverse DNS lookup; otherwise, IP address or Unix domain +// socket name. +func ClientAddress(val string) attribute.KeyValue { + return ClientAddressKey.String(val) +} + +// ClientPort returns an attribute KeyValue conforming to the "client.port" +// semantic conventions. It represents the client port number. +func ClientPort(val int) attribute.KeyValue { + return ClientPortKey.Int(val) +} + +// Namespace: cloud +const ( + // CloudAccountIDKey is the attribute Key conforming to the "cloud.account.id" + // semantic conventions. It represents the cloud account ID the resource is + // assigned to. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "111111111111", "opentelemetry" + CloudAccountIDKey = attribute.Key("cloud.account.id") + + // CloudAvailabilityZoneKey is the attribute Key conforming to the + // "cloud.availability_zone" semantic conventions. It represents the cloud + // regions often have multiple, isolated locations known as zones to increase + // availability. Availability zone represents the zone where the resource is + // running. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-east-1c" + // Note: Availability zones are called "zones" on Alibaba Cloud and Google + // Cloud. + CloudAvailabilityZoneKey = attribute.Key("cloud.availability_zone") + + // CloudPlatformKey is the attribute Key conforming to the "cloud.platform" + // semantic conventions. It represents the cloud platform in use. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The prefix of the service SHOULD match the one specified in + // `cloud.provider`. + CloudPlatformKey = attribute.Key("cloud.platform") + + // CloudProviderKey is the attribute Key conforming to the "cloud.provider" + // semantic conventions. It represents the name of the cloud provider. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + CloudProviderKey = attribute.Key("cloud.provider") + + // CloudRegionKey is the attribute Key conforming to the "cloud.region" semantic + // conventions. It represents the geographical region within a cloud provider. + // When associated with a resource, this attribute specifies the region where + // the resource operates. When calling services or APIs deployed on a cloud, + // this attribute identifies the region where the called destination is + // deployed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-central1", "us-east-1" + // Note: Refer to your provider's docs to see the available regions, for example + // [Alibaba Cloud regions], [AWS regions], [Azure regions], + // [Google Cloud regions], or [Tencent Cloud regions]. + // + // [Alibaba Cloud regions]: https://www.alibabacloud.com/help/doc-detail/40654.htm + // [AWS regions]: https://aws.amazon.com/about-aws/global-infrastructure/regions_az/ + // [Azure regions]: https://azure.microsoft.com/global-infrastructure/geographies/ + // [Google Cloud regions]: https://cloud.google.com/about/locations + // [Tencent Cloud regions]: https://www.tencentcloud.com/document/product/213/6091 + CloudRegionKey = attribute.Key("cloud.region") + + // CloudResourceIDKey is the attribute Key conforming to the "cloud.resource_id" + // semantic conventions. It represents the cloud provider-specific native + // identifier of the monitored cloud resource (e.g. an [ARN] on AWS, a + // [fully qualified resource ID] on Azure, a [full resource name] on GCP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:lambda:REGION:ACCOUNT_ID:function:my-function", + // "//run.googleapis.com/projects/PROJECT_ID/locations/LOCATION_ID/services/SERVICE_ID", + // "/subscriptions//resourceGroups/ + // /providers/Microsoft.Web/sites//functions/" + // Note: On some cloud providers, it may not be possible to determine the full + // ID at startup, + // so it may be necessary to set `cloud.resource_id` as a span attribute + // instead. + // + // The exact value to use for `cloud.resource_id` depends on the cloud provider. + // The following well-known definitions MUST be used if you set this attribute + // and they apply: + // + // - **AWS Lambda:** The function [ARN]. + // Take care not to use the "invoked ARN" directly but replace any + // [alias suffix] + // with the resolved function version, as the same runtime instance may be + // invocable with + // multiple different aliases. + // - **GCP:** The [URI of the resource] + // - **Azure:** The [Fully Qualified Resource ID] of the invoked function, + // *not* the function app, having the form + // + // `/subscriptions//resourceGroups//providers/Microsoft.Web/sites//functions/` + // . + // This means that a span attribute MUST be used, as an Azure function app + // can host multiple functions that would usually share + // a TracerProvider. + // + // + // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html + // [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id + // [full resource name]: https://google.aip.dev/122#full-resource-names + // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html + // [alias suffix]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-aliases.html + // [URI of the resource]: https://cloud.google.com/iam/docs/full-resource-names + // [Fully Qualified Resource ID]: https://docs.microsoft.com/rest/api/resources/resources/get-by-id + CloudResourceIDKey = attribute.Key("cloud.resource_id") +) + +// CloudAccountID returns an attribute KeyValue conforming to the +// "cloud.account.id" semantic conventions. It represents the cloud account ID +// the resource is assigned to. +func CloudAccountID(val string) attribute.KeyValue { + return CloudAccountIDKey.String(val) +} + +// CloudAvailabilityZone returns an attribute KeyValue conforming to the +// "cloud.availability_zone" semantic conventions. It represents the cloud +// regions often have multiple, isolated locations known as zones to increase +// availability. Availability zone represents the zone where the resource is +// running. +func CloudAvailabilityZone(val string) attribute.KeyValue { + return CloudAvailabilityZoneKey.String(val) +} + +// CloudRegion returns an attribute KeyValue conforming to the "cloud.region" +// semantic conventions. It represents the geographical region within a cloud +// provider. When associated with a resource, this attribute specifies the region +// where the resource operates. When calling services or APIs deployed on a +// cloud, this attribute identifies the region where the called destination is +// deployed. +func CloudRegion(val string) attribute.KeyValue { + return CloudRegionKey.String(val) +} + +// CloudResourceID returns an attribute KeyValue conforming to the +// "cloud.resource_id" semantic conventions. It represents the cloud +// provider-specific native identifier of the monitored cloud resource (e.g. an +// [ARN] on AWS, a [fully qualified resource ID] on Azure, a [full resource name] +// on GCP). +// +// [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html +// [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id +// [full resource name]: https://google.aip.dev/122#full-resource-names +func CloudResourceID(val string) attribute.KeyValue { + return CloudResourceIDKey.String(val) +} + +// Enum values for cloud.platform +var ( + // Alibaba Cloud Elastic Compute Service + // Stability: development + CloudPlatformAlibabaCloudECS = CloudPlatformKey.String("alibaba_cloud_ecs") + // Alibaba Cloud Function Compute + // Stability: development + CloudPlatformAlibabaCloudFC = CloudPlatformKey.String("alibaba_cloud_fc") + // Red Hat OpenShift on Alibaba Cloud + // Stability: development + CloudPlatformAlibabaCloudOpenShift = CloudPlatformKey.String("alibaba_cloud_openshift") + // AWS Elastic Compute Cloud + // Stability: development + CloudPlatformAWSEC2 = CloudPlatformKey.String("aws_ec2") + // AWS Elastic Container Service + // Stability: development + CloudPlatformAWSECS = CloudPlatformKey.String("aws_ecs") + // AWS Elastic Kubernetes Service + // Stability: development + CloudPlatformAWSEKS = CloudPlatformKey.String("aws_eks") + // AWS Lambda + // Stability: development + CloudPlatformAWSLambda = CloudPlatformKey.String("aws_lambda") + // AWS Elastic Beanstalk + // Stability: development + CloudPlatformAWSElasticBeanstalk = CloudPlatformKey.String("aws_elastic_beanstalk") + // AWS App Runner + // Stability: development + CloudPlatformAWSAppRunner = CloudPlatformKey.String("aws_app_runner") + // Red Hat OpenShift on AWS (ROSA) + // Stability: development + CloudPlatformAWSOpenShift = CloudPlatformKey.String("aws_openshift") + // Azure Virtual Machines + // Stability: development + CloudPlatformAzureVM = CloudPlatformKey.String("azure_vm") + // Azure Container Apps + // Stability: development + CloudPlatformAzureContainerApps = CloudPlatformKey.String("azure_container_apps") + // Azure Container Instances + // Stability: development + CloudPlatformAzureContainerInstances = CloudPlatformKey.String("azure_container_instances") + // Azure Kubernetes Service + // Stability: development + CloudPlatformAzureAKS = CloudPlatformKey.String("azure_aks") + // Azure Functions + // Stability: development + CloudPlatformAzureFunctions = CloudPlatformKey.String("azure_functions") + // Azure App Service + // Stability: development + CloudPlatformAzureAppService = CloudPlatformKey.String("azure_app_service") + // Azure Red Hat OpenShift + // Stability: development + CloudPlatformAzureOpenShift = CloudPlatformKey.String("azure_openshift") + // Google Bare Metal Solution (BMS) + // Stability: development + CloudPlatformGCPBareMetalSolution = CloudPlatformKey.String("gcp_bare_metal_solution") + // Google Cloud Compute Engine (GCE) + // Stability: development + CloudPlatformGCPComputeEngine = CloudPlatformKey.String("gcp_compute_engine") + // Google Cloud Run + // Stability: development + CloudPlatformGCPCloudRun = CloudPlatformKey.String("gcp_cloud_run") + // Google Cloud Kubernetes Engine (GKE) + // Stability: development + CloudPlatformGCPKubernetesEngine = CloudPlatformKey.String("gcp_kubernetes_engine") + // Google Cloud Functions (GCF) + // Stability: development + CloudPlatformGCPCloudFunctions = CloudPlatformKey.String("gcp_cloud_functions") + // Google Cloud App Engine (GAE) + // Stability: development + CloudPlatformGCPAppEngine = CloudPlatformKey.String("gcp_app_engine") + // Red Hat OpenShift on Google Cloud + // Stability: development + CloudPlatformGCPOpenShift = CloudPlatformKey.String("gcp_openshift") + // Red Hat OpenShift on IBM Cloud + // Stability: development + CloudPlatformIBMCloudOpenShift = CloudPlatformKey.String("ibm_cloud_openshift") + // Compute on Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudPlatformOracleCloudCompute = CloudPlatformKey.String("oracle_cloud_compute") + // Kubernetes Engine (OKE) on Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudPlatformOracleCloudOKE = CloudPlatformKey.String("oracle_cloud_oke") + // Tencent Cloud Cloud Virtual Machine (CVM) + // Stability: development + CloudPlatformTencentCloudCVM = CloudPlatformKey.String("tencent_cloud_cvm") + // Tencent Cloud Elastic Kubernetes Service (EKS) + // Stability: development + CloudPlatformTencentCloudEKS = CloudPlatformKey.String("tencent_cloud_eks") + // Tencent Cloud Serverless Cloud Function (SCF) + // Stability: development + CloudPlatformTencentCloudSCF = CloudPlatformKey.String("tencent_cloud_scf") +) + +// Enum values for cloud.provider +var ( + // Alibaba Cloud + // Stability: development + CloudProviderAlibabaCloud = CloudProviderKey.String("alibaba_cloud") + // Amazon Web Services + // Stability: development + CloudProviderAWS = CloudProviderKey.String("aws") + // Microsoft Azure + // Stability: development + CloudProviderAzure = CloudProviderKey.String("azure") + // Google Cloud Platform + // Stability: development + CloudProviderGCP = CloudProviderKey.String("gcp") + // Heroku Platform as a Service + // Stability: development + CloudProviderHeroku = CloudProviderKey.String("heroku") + // IBM Cloud + // Stability: development + CloudProviderIBMCloud = CloudProviderKey.String("ibm_cloud") + // Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudProviderOracleCloud = CloudProviderKey.String("oracle_cloud") + // Tencent Cloud + // Stability: development + CloudProviderTencentCloud = CloudProviderKey.String("tencent_cloud") +) + +// Namespace: cloudevents +const ( + // CloudEventsEventIDKey is the attribute Key conforming to the + // "cloudevents.event_id" semantic conventions. It represents the [event_id] + // uniquely identifies the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123e4567-e89b-12d3-a456-426614174000", "0001" + // + // [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id + CloudEventsEventIDKey = attribute.Key("cloudevents.event_id") + + // CloudEventsEventSourceKey is the attribute Key conforming to the + // "cloudevents.event_source" semantic conventions. It represents the [source] + // identifies the context in which an event happened. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://github.com/cloudevents", "/cloudevents/spec/pull/123", + // "my-service" + // + // [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1 + CloudEventsEventSourceKey = attribute.Key("cloudevents.event_source") + + // CloudEventsEventSpecVersionKey is the attribute Key conforming to the + // "cloudevents.event_spec_version" semantic conventions. It represents the + // [version of the CloudEvents specification] which the event uses. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + // + // [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion + CloudEventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version") + + // CloudEventsEventSubjectKey is the attribute Key conforming to the + // "cloudevents.event_subject" semantic conventions. It represents the [subject] + // of the event in the context of the event producer (identified by source). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: mynewfile.jpg + // + // [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject + CloudEventsEventSubjectKey = attribute.Key("cloudevents.event_subject") + + // CloudEventsEventTypeKey is the attribute Key conforming to the + // "cloudevents.event_type" semantic conventions. It represents the [event_type] + // contains a value describing the type of event related to the originating + // occurrence. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "com.github.pull_request.opened", "com.example.object.deleted.v2" + // + // [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type + CloudEventsEventTypeKey = attribute.Key("cloudevents.event_type") +) + +// CloudEventsEventID returns an attribute KeyValue conforming to the +// "cloudevents.event_id" semantic conventions. It represents the [event_id] +// uniquely identifies the event. +// +// [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id +func CloudEventsEventID(val string) attribute.KeyValue { + return CloudEventsEventIDKey.String(val) +} + +// CloudEventsEventSource returns an attribute KeyValue conforming to the +// "cloudevents.event_source" semantic conventions. It represents the [source] +// identifies the context in which an event happened. +// +// [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1 +func CloudEventsEventSource(val string) attribute.KeyValue { + return CloudEventsEventSourceKey.String(val) +} + +// CloudEventsEventSpecVersion returns an attribute KeyValue conforming to the +// "cloudevents.event_spec_version" semantic conventions. It represents the +// [version of the CloudEvents specification] which the event uses. +// +// [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion +func CloudEventsEventSpecVersion(val string) attribute.KeyValue { + return CloudEventsEventSpecVersionKey.String(val) +} + +// CloudEventsEventSubject returns an attribute KeyValue conforming to the +// "cloudevents.event_subject" semantic conventions. It represents the [subject] +// of the event in the context of the event producer (identified by source). +// +// [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject +func CloudEventsEventSubject(val string) attribute.KeyValue { + return CloudEventsEventSubjectKey.String(val) +} + +// CloudEventsEventType returns an attribute KeyValue conforming to the +// "cloudevents.event_type" semantic conventions. It represents the [event_type] +// contains a value describing the type of event related to the originating +// occurrence. +// +// [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type +func CloudEventsEventType(val string) attribute.KeyValue { + return CloudEventsEventTypeKey.String(val) +} + +// Namespace: cloudfoundry +const ( + // CloudFoundryAppIDKey is the attribute Key conforming to the + // "cloudfoundry.app.id" semantic conventions. It represents the guid of the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.application_id`. This is the same value as + // reported by `cf app --guid`. + CloudFoundryAppIDKey = attribute.Key("cloudfoundry.app.id") + + // CloudFoundryAppInstanceIDKey is the attribute Key conforming to the + // "cloudfoundry.app.instance.id" semantic conventions. It represents the index + // of the application instance. 0 when just one instance is active. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0", "1" + // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope] + // . + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the application instance index for applications + // deployed on the runtime. + // + // Application instrumentation should use the value from environment + // variable `CF_INSTANCE_INDEX`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + CloudFoundryAppInstanceIDKey = attribute.Key("cloudfoundry.app.instance.id") + + // CloudFoundryAppNameKey is the attribute Key conforming to the + // "cloudfoundry.app.name" semantic conventions. It represents the name of the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-app-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.application_name`. This is the same value + // as reported by `cf apps`. + CloudFoundryAppNameKey = attribute.Key("cloudfoundry.app.name") + + // CloudFoundryOrgIDKey is the attribute Key conforming to the + // "cloudfoundry.org.id" semantic conventions. It represents the guid of the + // CloudFoundry org the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.org_id`. This is the same value as + // reported by `cf org --guid`. + CloudFoundryOrgIDKey = attribute.Key("cloudfoundry.org.id") + + // CloudFoundryOrgNameKey is the attribute Key conforming to the + // "cloudfoundry.org.name" semantic conventions. It represents the name of the + // CloudFoundry organization the app is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-org-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.org_name`. This is the same value as + // reported by `cf orgs`. + CloudFoundryOrgNameKey = attribute.Key("cloudfoundry.org.name") + + // CloudFoundryProcessIDKey is the attribute Key conforming to the + // "cloudfoundry.process.id" semantic conventions. It represents the UID + // identifying the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.process_id`. It is supposed to be equal to + // `VCAP_APPLICATION.app_id` for applications deployed to the runtime. + // For system components, this could be the actual PID. + CloudFoundryProcessIDKey = attribute.Key("cloudfoundry.process.id") + + // CloudFoundryProcessTypeKey is the attribute Key conforming to the + // "cloudfoundry.process.type" semantic conventions. It represents the type of + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "web" + // Note: CloudFoundry applications can consist of multiple jobs. Usually the + // main process will be of type `web`. There can be additional background + // tasks or side-cars with different process types. + CloudFoundryProcessTypeKey = attribute.Key("cloudfoundry.process.type") + + // CloudFoundrySpaceIDKey is the attribute Key conforming to the + // "cloudfoundry.space.id" semantic conventions. It represents the guid of the + // CloudFoundry space the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.space_id`. This is the same value as + // reported by `cf space --guid`. + CloudFoundrySpaceIDKey = attribute.Key("cloudfoundry.space.id") + + // CloudFoundrySpaceNameKey is the attribute Key conforming to the + // "cloudfoundry.space.name" semantic conventions. It represents the name of the + // CloudFoundry space the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-space-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.space_name`. This is the same value as + // reported by `cf spaces`. + CloudFoundrySpaceNameKey = attribute.Key("cloudfoundry.space.name") + + // CloudFoundrySystemIDKey is the attribute Key conforming to the + // "cloudfoundry.system.id" semantic conventions. It represents a guid or + // another name describing the event source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cf/gorouter" + // Note: CloudFoundry defines the `source_id` in the [Loggregator v2 envelope]. + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the component name, e.g. "gorouter", for + // CloudFoundry components. + // + // When system components are instrumented, values from the + // [Bosh spec] + // should be used. The `system.id` should be set to + // `spec.deployment/spec.name`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec + CloudFoundrySystemIDKey = attribute.Key("cloudfoundry.system.id") + + // CloudFoundrySystemInstanceIDKey is the attribute Key conforming to the + // "cloudfoundry.system.instance.id" semantic conventions. It represents a guid + // describing the concrete instance of the event source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope] + // . + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the vm id for CloudFoundry components. + // + // When system components are instrumented, values from the + // [Bosh spec] + // should be used. The `system.instance.id` should be set to `spec.id`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec + CloudFoundrySystemInstanceIDKey = attribute.Key("cloudfoundry.system.instance.id") +) + +// CloudFoundryAppID returns an attribute KeyValue conforming to the +// "cloudfoundry.app.id" semantic conventions. It represents the guid of the +// application. +func CloudFoundryAppID(val string) attribute.KeyValue { + return CloudFoundryAppIDKey.String(val) +} + +// CloudFoundryAppInstanceID returns an attribute KeyValue conforming to the +// "cloudfoundry.app.instance.id" semantic conventions. It represents the index +// of the application instance. 0 when just one instance is active. +func CloudFoundryAppInstanceID(val string) attribute.KeyValue { + return CloudFoundryAppInstanceIDKey.String(val) +} + +// CloudFoundryAppName returns an attribute KeyValue conforming to the +// "cloudfoundry.app.name" semantic conventions. It represents the name of the +// application. +func CloudFoundryAppName(val string) attribute.KeyValue { + return CloudFoundryAppNameKey.String(val) +} + +// CloudFoundryOrgID returns an attribute KeyValue conforming to the +// "cloudfoundry.org.id" semantic conventions. It represents the guid of the +// CloudFoundry org the application is running in. +func CloudFoundryOrgID(val string) attribute.KeyValue { + return CloudFoundryOrgIDKey.String(val) +} + +// CloudFoundryOrgName returns an attribute KeyValue conforming to the +// "cloudfoundry.org.name" semantic conventions. It represents the name of the +// CloudFoundry organization the app is running in. +func CloudFoundryOrgName(val string) attribute.KeyValue { + return CloudFoundryOrgNameKey.String(val) +} + +// CloudFoundryProcessID returns an attribute KeyValue conforming to the +// "cloudfoundry.process.id" semantic conventions. It represents the UID +// identifying the process. +func CloudFoundryProcessID(val string) attribute.KeyValue { + return CloudFoundryProcessIDKey.String(val) +} + +// CloudFoundryProcessType returns an attribute KeyValue conforming to the +// "cloudfoundry.process.type" semantic conventions. It represents the type of +// process. +func CloudFoundryProcessType(val string) attribute.KeyValue { + return CloudFoundryProcessTypeKey.String(val) +} + +// CloudFoundrySpaceID returns an attribute KeyValue conforming to the +// "cloudfoundry.space.id" semantic conventions. It represents the guid of the +// CloudFoundry space the application is running in. +func CloudFoundrySpaceID(val string) attribute.KeyValue { + return CloudFoundrySpaceIDKey.String(val) +} + +// CloudFoundrySpaceName returns an attribute KeyValue conforming to the +// "cloudfoundry.space.name" semantic conventions. It represents the name of the +// CloudFoundry space the application is running in. +func CloudFoundrySpaceName(val string) attribute.KeyValue { + return CloudFoundrySpaceNameKey.String(val) +} + +// CloudFoundrySystemID returns an attribute KeyValue conforming to the +// "cloudfoundry.system.id" semantic conventions. It represents a guid or another +// name describing the event source. +func CloudFoundrySystemID(val string) attribute.KeyValue { + return CloudFoundrySystemIDKey.String(val) +} + +// CloudFoundrySystemInstanceID returns an attribute KeyValue conforming to the +// "cloudfoundry.system.instance.id" semantic conventions. It represents a guid +// describing the concrete instance of the event source. +func CloudFoundrySystemInstanceID(val string) attribute.KeyValue { + return CloudFoundrySystemInstanceIDKey.String(val) +} + +// Namespace: code +const ( + // CodeColumnNumberKey is the attribute Key conforming to the + // "code.column.number" semantic conventions. It represents the column number in + // `code.file.path` best representing the operation. It SHOULD point within the + // code unit named in `code.function.name`. This attribute MUST NOT be used on + // the Profile signal since the data is already captured in 'message Line'. This + // constraint is imposed to prevent redundancy and maintain data integrity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + CodeColumnNumberKey = attribute.Key("code.column.number") + + // CodeFilePathKey is the attribute Key conforming to the "code.file.path" + // semantic conventions. It represents the source code file name that identifies + // the code unit as uniquely as possible (preferably an absolute file path). + // This attribute MUST NOT be used on the Profile signal since the data is + // already captured in 'message Function'. This constraint is imposed to prevent + // redundancy and maintain data integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: /usr/local/MyApplication/content_root/app/index.php + CodeFilePathKey = attribute.Key("code.file.path") + + // CodeFunctionNameKey is the attribute Key conforming to the + // "code.function.name" semantic conventions. It represents the method or + // function fully-qualified name without arguments. The value should fit the + // natural representation of the language runtime, which is also likely the same + // used within `code.stacktrace` attribute value. This attribute MUST NOT be + // used on the Profile signal since the data is already captured in 'message + // Function'. This constraint is imposed to prevent redundancy and maintain data + // integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "com.example.MyHttpService.serveRequest", + // "GuzzleHttp\Client::transfer", "fopen" + // Note: Values and format depends on each language runtime, thus it is + // impossible to provide an exhaustive list of examples. + // The values are usually the same (or prefixes of) the ones found in native + // stack trace representation stored in + // `code.stacktrace` without information on arguments. + // + // Examples: + // + // - Java method: `com.example.MyHttpService.serveRequest` + // - Java anonymous class method: `com.mycompany.Main$1.myMethod` + // - Java lambda method: + // `com.mycompany.Main$$Lambda/0x0000748ae4149c00.myMethod` + // - PHP function: `GuzzleHttp\Client::transfer` + // - Go function: `github.com/my/repo/pkg.foo.func5` + // - Elixir: `OpenTelemetry.Ctx.new` + // - Erlang: `opentelemetry_ctx:new` + // - Rust: `playground::my_module::my_cool_func` + // - C function: `fopen` + CodeFunctionNameKey = attribute.Key("code.function.name") + + // CodeLineNumberKey is the attribute Key conforming to the "code.line.number" + // semantic conventions. It represents the line number in `code.file.path` best + // representing the operation. It SHOULD point within the code unit named in + // `code.function.name`. This attribute MUST NOT be used on the Profile signal + // since the data is already captured in 'message Line'. This constraint is + // imposed to prevent redundancy and maintain data integrity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + CodeLineNumberKey = attribute.Key("code.line.number") + + // CodeStacktraceKey is the attribute Key conforming to the "code.stacktrace" + // semantic conventions. It represents a stacktrace as a string in the natural + // representation for the language runtime. The representation is identical to + // [`exception.stacktrace`]. This attribute MUST NOT be used on the Profile + // signal since the data is already captured in 'message Location'. This + // constraint is imposed to prevent redundancy and maintain data integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at + // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at + // com.example.GenerateTrace.main(GenerateTrace.java:5) + // + // [`exception.stacktrace`]: /docs/exceptions/exceptions-spans.md#stacktrace-representation + CodeStacktraceKey = attribute.Key("code.stacktrace") +) + +// CodeColumnNumber returns an attribute KeyValue conforming to the +// "code.column.number" semantic conventions. It represents the column number in +// `code.file.path` best representing the operation. It SHOULD point within the +// code unit named in `code.function.name`. This attribute MUST NOT be used on +// the Profile signal since the data is already captured in 'message Line'. This +// constraint is imposed to prevent redundancy and maintain data integrity. +func CodeColumnNumber(val int) attribute.KeyValue { + return CodeColumnNumberKey.Int(val) +} + +// CodeFilePath returns an attribute KeyValue conforming to the "code.file.path" +// semantic conventions. It represents the source code file name that identifies +// the code unit as uniquely as possible (preferably an absolute file path). This +// attribute MUST NOT be used on the Profile signal since the data is already +// captured in 'message Function'. This constraint is imposed to prevent +// redundancy and maintain data integrity. +func CodeFilePath(val string) attribute.KeyValue { + return CodeFilePathKey.String(val) +} + +// CodeFunctionName returns an attribute KeyValue conforming to the +// "code.function.name" semantic conventions. It represents the method or +// function fully-qualified name without arguments. The value should fit the +// natural representation of the language runtime, which is also likely the same +// used within `code.stacktrace` attribute value. This attribute MUST NOT be used +// on the Profile signal since the data is already captured in 'message +// Function'. This constraint is imposed to prevent redundancy and maintain data +// integrity. +func CodeFunctionName(val string) attribute.KeyValue { + return CodeFunctionNameKey.String(val) +} + +// CodeLineNumber returns an attribute KeyValue conforming to the +// "code.line.number" semantic conventions. It represents the line number in +// `code.file.path` best representing the operation. It SHOULD point within the +// code unit named in `code.function.name`. This attribute MUST NOT be used on +// the Profile signal since the data is already captured in 'message Line'. This +// constraint is imposed to prevent redundancy and maintain data integrity. +func CodeLineNumber(val int) attribute.KeyValue { + return CodeLineNumberKey.Int(val) +} + +// CodeStacktrace returns an attribute KeyValue conforming to the +// "code.stacktrace" semantic conventions. It represents a stacktrace as a string +// in the natural representation for the language runtime. The representation is +// identical to [`exception.stacktrace`]. This attribute MUST NOT be used on the +// Profile signal since the data is already captured in 'message Location'. This +// constraint is imposed to prevent redundancy and maintain data integrity. +// +// [`exception.stacktrace`]: /docs/exceptions/exceptions-spans.md#stacktrace-representation +func CodeStacktrace(val string) attribute.KeyValue { + return CodeStacktraceKey.String(val) +} + +// Namespace: container +const ( + // ContainerCommandKey is the attribute Key conforming to the + // "container.command" semantic conventions. It represents the command used to + // run the container (i.e. the command name). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol" + // Note: If using embedded credentials or sensitive data, it is recommended to + // remove them to prevent potential leakage. + ContainerCommandKey = attribute.Key("container.command") + + // ContainerCommandArgsKey is the attribute Key conforming to the + // "container.command_args" semantic conventions. It represents the all the + // command arguments (including the command/executable itself) run by the + // container. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol", "--config", "config.yaml" + ContainerCommandArgsKey = attribute.Key("container.command_args") + + // ContainerCommandLineKey is the attribute Key conforming to the + // "container.command_line" semantic conventions. It represents the full command + // run by the container as a single string representing the full command. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol --config config.yaml" + ContainerCommandLineKey = attribute.Key("container.command_line") + + // ContainerCSIPluginNameKey is the attribute Key conforming to the + // "container.csi.plugin.name" semantic conventions. It represents the name of + // the CSI ([Container Storage Interface]) plugin used by the volume. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pd.csi.storage.gke.io" + // Note: This can sometimes be referred to as a "driver" in CSI implementations. + // This should represent the `name` field of the GetPluginInfo RPC. + // + // [Container Storage Interface]: https://github.com/container-storage-interface/spec + ContainerCSIPluginNameKey = attribute.Key("container.csi.plugin.name") + + // ContainerCSIVolumeIDKey is the attribute Key conforming to the + // "container.csi.volume.id" semantic conventions. It represents the unique + // volume ID returned by the CSI ([Container Storage Interface]) plugin. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "projects/my-gcp-project/zones/my-gcp-zone/disks/my-gcp-disk" + // Note: This can sometimes be referred to as a "volume handle" in CSI + // implementations. This should represent the `Volume.volume_id` field in CSI + // spec. + // + // [Container Storage Interface]: https://github.com/container-storage-interface/spec + ContainerCSIVolumeIDKey = attribute.Key("container.csi.volume.id") + + // ContainerIDKey is the attribute Key conforming to the "container.id" semantic + // conventions. It represents the container ID. Usually a UUID, as for example + // used to [identify Docker containers]. The UUID might be abbreviated. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a3bf90e006b2" + // + // [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification + ContainerIDKey = attribute.Key("container.id") + + // ContainerImageIDKey is the attribute Key conforming to the + // "container.image.id" semantic conventions. It represents the runtime specific + // image identifier. Usually a hash algorithm followed by a UUID. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "sha256:19c92d0a00d1b66d897bceaa7319bee0dd38a10a851c60bcec9474aa3f01e50f" + // Note: Docker defines a sha256 of the image id; `container.image.id` + // corresponds to the `Image` field from the Docker container inspect [API] + // endpoint. + // K8s defines a link to the container registry repository with digest + // `"imageID": "registry.azurecr.io /namespace/service/dockerfile@sha256:bdeabd40c3a8a492eaf9e8e44d0ebbb84bac7ee25ac0cf8a7159d25f62555625"` + // . + // The ID is assigned by the container runtime and can vary in different + // environments. Consider using `oci.manifest.digest` if it is important to + // identify the same image in different environments/runtimes. + // + // [API]: https://docs.docker.com/engine/api/v1.43/#tag/Container/operation/ContainerInspect + ContainerImageIDKey = attribute.Key("container.image.id") + + // ContainerImageNameKey is the attribute Key conforming to the + // "container.image.name" semantic conventions. It represents the name of the + // image the container was built on. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "gcr.io/opentelemetry/operator" + ContainerImageNameKey = attribute.Key("container.image.name") + + // ContainerImageRepoDigestsKey is the attribute Key conforming to the + // "container.image.repo_digests" semantic conventions. It represents the repo + // digests of the container image as provided by the container runtime. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "example@sha256:afcc7f1ac1b49db317a7196c902e61c6c3c4607d63599ee1a82d702d249a0ccb", + // "internal.registry.example.com:5000/example@sha256:b69959407d21e8a062e0416bf13405bb2b71ed7a84dde4158ebafacfa06f5578" + // Note: [Docker] and [CRI] report those under the `RepoDigests` field. + // + // [Docker]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect + // [CRI]: https://github.com/kubernetes/cri-api/blob/c75ef5b473bbe2d0a4fc92f82235efd665ea8e9f/pkg/apis/runtime/v1/api.proto#L1237-L1238 + ContainerImageRepoDigestsKey = attribute.Key("container.image.repo_digests") + + // ContainerImageTagsKey is the attribute Key conforming to the + // "container.image.tags" semantic conventions. It represents the container + // image tags. An example can be found in [Docker Image Inspect]. Should be only + // the `` section of the full name for example from + // `registry.example.com/my-org/my-image:`. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "v1.27.1", "3.5.7-0" + // + // [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect + ContainerImageTagsKey = attribute.Key("container.image.tags") + + // ContainerNameKey is the attribute Key conforming to the "container.name" + // semantic conventions. It represents the container name used by container + // runtime. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-autoconf" + ContainerNameKey = attribute.Key("container.name") + + // ContainerRuntimeKey is the attribute Key conforming to the + // "container.runtime" semantic conventions. It represents the container runtime + // managing this container. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "docker", "containerd", "rkt" + ContainerRuntimeKey = attribute.Key("container.runtime") +) + +// ContainerCommand returns an attribute KeyValue conforming to the +// "container.command" semantic conventions. It represents the command used to +// run the container (i.e. the command name). +func ContainerCommand(val string) attribute.KeyValue { + return ContainerCommandKey.String(val) +} + +// ContainerCommandArgs returns an attribute KeyValue conforming to the +// "container.command_args" semantic conventions. It represents the all the +// command arguments (including the command/executable itself) run by the +// container. +func ContainerCommandArgs(val ...string) attribute.KeyValue { + return ContainerCommandArgsKey.StringSlice(val) +} + +// ContainerCommandLine returns an attribute KeyValue conforming to the +// "container.command_line" semantic conventions. It represents the full command +// run by the container as a single string representing the full command. +func ContainerCommandLine(val string) attribute.KeyValue { + return ContainerCommandLineKey.String(val) +} + +// ContainerCSIPluginName returns an attribute KeyValue conforming to the +// "container.csi.plugin.name" semantic conventions. It represents the name of +// the CSI ([Container Storage Interface]) plugin used by the volume. +// +// [Container Storage Interface]: https://github.com/container-storage-interface/spec +func ContainerCSIPluginName(val string) attribute.KeyValue { + return ContainerCSIPluginNameKey.String(val) +} + +// ContainerCSIVolumeID returns an attribute KeyValue conforming to the +// "container.csi.volume.id" semantic conventions. It represents the unique +// volume ID returned by the CSI ([Container Storage Interface]) plugin. +// +// [Container Storage Interface]: https://github.com/container-storage-interface/spec +func ContainerCSIVolumeID(val string) attribute.KeyValue { + return ContainerCSIVolumeIDKey.String(val) +} + +// ContainerID returns an attribute KeyValue conforming to the "container.id" +// semantic conventions. It represents the container ID. Usually a UUID, as for +// example used to [identify Docker containers]. The UUID might be abbreviated. +// +// [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification +func ContainerID(val string) attribute.KeyValue { + return ContainerIDKey.String(val) +} + +// ContainerImageID returns an attribute KeyValue conforming to the +// "container.image.id" semantic conventions. It represents the runtime specific +// image identifier. Usually a hash algorithm followed by a UUID. +func ContainerImageID(val string) attribute.KeyValue { + return ContainerImageIDKey.String(val) +} + +// ContainerImageName returns an attribute KeyValue conforming to the +// "container.image.name" semantic conventions. It represents the name of the +// image the container was built on. +func ContainerImageName(val string) attribute.KeyValue { + return ContainerImageNameKey.String(val) +} + +// ContainerImageRepoDigests returns an attribute KeyValue conforming to the +// "container.image.repo_digests" semantic conventions. It represents the repo +// digests of the container image as provided by the container runtime. +func ContainerImageRepoDigests(val ...string) attribute.KeyValue { + return ContainerImageRepoDigestsKey.StringSlice(val) +} + +// ContainerImageTags returns an attribute KeyValue conforming to the +// "container.image.tags" semantic conventions. It represents the container image +// tags. An example can be found in [Docker Image Inspect]. Should be only the +// `` section of the full name for example from +// `registry.example.com/my-org/my-image:`. +// +// [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect +func ContainerImageTags(val ...string) attribute.KeyValue { + return ContainerImageTagsKey.StringSlice(val) +} + +// ContainerName returns an attribute KeyValue conforming to the "container.name" +// semantic conventions. It represents the container name used by container +// runtime. +func ContainerName(val string) attribute.KeyValue { + return ContainerNameKey.String(val) +} + +// ContainerRuntime returns an attribute KeyValue conforming to the +// "container.runtime" semantic conventions. It represents the container runtime +// managing this container. +func ContainerRuntime(val string) attribute.KeyValue { + return ContainerRuntimeKey.String(val) +} + +// Namespace: cpu +const ( + // CPULogicalNumberKey is the attribute Key conforming to the + // "cpu.logical_number" semantic conventions. It represents the logical CPU + // number [0..n-1]. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + CPULogicalNumberKey = attribute.Key("cpu.logical_number") + + // CPUModeKey is the attribute Key conforming to the "cpu.mode" semantic + // conventions. It represents the mode of the CPU. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "user", "system" + CPUModeKey = attribute.Key("cpu.mode") +) + +// CPULogicalNumber returns an attribute KeyValue conforming to the +// "cpu.logical_number" semantic conventions. It represents the logical CPU +// number [0..n-1]. +func CPULogicalNumber(val int) attribute.KeyValue { + return CPULogicalNumberKey.Int(val) +} + +// Enum values for cpu.mode +var ( + // user + // Stability: development + CPUModeUser = CPUModeKey.String("user") + // system + // Stability: development + CPUModeSystem = CPUModeKey.String("system") + // nice + // Stability: development + CPUModeNice = CPUModeKey.String("nice") + // idle + // Stability: development + CPUModeIdle = CPUModeKey.String("idle") + // iowait + // Stability: development + CPUModeIOWait = CPUModeKey.String("iowait") + // interrupt + // Stability: development + CPUModeInterrupt = CPUModeKey.String("interrupt") + // steal + // Stability: development + CPUModeSteal = CPUModeKey.String("steal") + // kernel + // Stability: development + CPUModeKernel = CPUModeKey.String("kernel") +) + +// Namespace: db +const ( + // DBClientConnectionPoolNameKey is the attribute Key conforming to the + // "db.client.connection.pool.name" semantic conventions. It represents the name + // of the connection pool; unique within the instrumented application. In case + // the connection pool implementation doesn't provide a name, instrumentation + // SHOULD use a combination of parameters that would make the name unique, for + // example, combining attributes `server.address`, `server.port`, and + // `db.namespace`, formatted as `server.address:server.port/db.namespace`. + // Instrumentations that generate connection pool name following different + // patterns SHOULD document it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myDataSource" + DBClientConnectionPoolNameKey = attribute.Key("db.client.connection.pool.name") + + // DBClientConnectionStateKey is the attribute Key conforming to the + // "db.client.connection.state" semantic conventions. It represents the state of + // a connection in the pool. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "idle" + DBClientConnectionStateKey = attribute.Key("db.client.connection.state") + + // DBCollectionNameKey is the attribute Key conforming to the + // "db.collection.name" semantic conventions. It represents the name of a + // collection (table, container) within the database. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "public.users", "customers" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // The collection name SHOULD NOT be extracted from `db.query.text`, + // when the database system supports query text with multiple collections + // in non-batch operations. + // + // For batch operations, if the individual operations are known to have the same + // collection name then that collection name SHOULD be used. + DBCollectionNameKey = attribute.Key("db.collection.name") + + // DBNamespaceKey is the attribute Key conforming to the "db.namespace" semantic + // conventions. It represents the name of the database, fully qualified within + // the server address and port. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "customers", "test.users" + // Note: If a database system has multiple namespace components, they SHOULD be + // concatenated from the most general to the most specific namespace component, + // using `|` as a separator between the components. Any missing components (and + // their associated separators) SHOULD be omitted. + // Semantic conventions for individual database systems SHOULD document what + // `db.namespace` means in the context of that system. + // It is RECOMMENDED to capture the value as provided by the application without + // attempting to do any case normalization. + DBNamespaceKey = attribute.Key("db.namespace") + + // DBOperationBatchSizeKey is the attribute Key conforming to the + // "db.operation.batch.size" semantic conventions. It represents the number of + // queries included in a batch operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 2, 3, 4 + // Note: Operations are only considered batches when they contain two or more + // operations, and so `db.operation.batch.size` SHOULD never be `1`. + DBOperationBatchSizeKey = attribute.Key("db.operation.batch.size") + + // DBOperationNameKey is the attribute Key conforming to the "db.operation.name" + // semantic conventions. It represents the name of the operation or command + // being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "findAndModify", "HMSET", "SELECT" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // The operation name SHOULD NOT be extracted from `db.query.text`, + // when the database system supports query text with multiple operations + // in non-batch operations. + // + // If spaces can occur in the operation name, multiple consecutive spaces + // SHOULD be normalized to a single space. + // + // For batch operations, if the individual operations are known to have the same + // operation name + // then that operation name SHOULD be used prepended by `BATCH `, + // otherwise `db.operation.name` SHOULD be `BATCH` or some other database + // system specific term if more applicable. + DBOperationNameKey = attribute.Key("db.operation.name") + + // DBQuerySummaryKey is the attribute Key conforming to the "db.query.summary" + // semantic conventions. It represents the low cardinality summary of a database + // query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "SELECT wuser_table", "INSERT shipping_details SELECT orders", "get + // user by id" + // Note: The query summary describes a class of database queries and is useful + // as a grouping key, especially when analyzing telemetry for database + // calls involving complex queries. + // + // Summary may be available to the instrumentation through + // instrumentation hooks or other means. If it is not available, + // instrumentations + // that support query parsing SHOULD generate a summary following + // [Generating query summary] + // section. + // + // [Generating query summary]: /docs/database/database-spans.md#generating-a-summary-of-the-query + DBQuerySummaryKey = attribute.Key("db.query.summary") + + // DBQueryTextKey is the attribute Key conforming to the "db.query.text" + // semantic conventions. It represents the database query being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "SELECT * FROM wuser_table where username = ?", "SET mykey ?" + // Note: For sanitization see [Sanitization of `db.query.text`]. + // For batch operations, if the individual operations are known to have the same + // query text then that query text SHOULD be used, otherwise all of the + // individual query texts SHOULD be concatenated with separator `; ` or some + // other database system specific separator if more applicable. + // Parameterized query text SHOULD NOT be sanitized. Even though parameterized + // query text can potentially have sensitive data, by using a parameterized + // query the user is giving a strong signal that any sensitive data will be + // passed as parameter values, and the benefit to observability of capturing the + // static part of the query text by default outweighs the risk. + // + // [Sanitization of `db.query.text`]: /docs/database/database-spans.md#sanitization-of-dbquerytext + DBQueryTextKey = attribute.Key("db.query.text") + + // DBResponseReturnedRowsKey is the attribute Key conforming to the + // "db.response.returned_rows" semantic conventions. It represents the number of + // rows returned by the operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10, 30, 1000 + DBResponseReturnedRowsKey = attribute.Key("db.response.returned_rows") + + // DBResponseStatusCodeKey is the attribute Key conforming to the + // "db.response.status_code" semantic conventions. It represents the database + // response status code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "102", "ORA-17002", "08P01", "404" + // Note: The status code returned by the database. Usually it represents an + // error code, but may also represent partial success, warning, or differentiate + // between various types of successful outcomes. + // Semantic conventions for individual database systems SHOULD document what + // `db.response.status_code` means in the context of that system. + DBResponseStatusCodeKey = attribute.Key("db.response.status_code") + + // DBStoredProcedureNameKey is the attribute Key conforming to the + // "db.stored_procedure.name" semantic conventions. It represents the name of a + // stored procedure within the database. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GetCustomer" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // For batch operations, if the individual operations are known to have the same + // stored procedure name then that stored procedure name SHOULD be used. + DBStoredProcedureNameKey = attribute.Key("db.stored_procedure.name") + + // DBSystemNameKey is the attribute Key conforming to the "db.system.name" + // semantic conventions. It represents the database management system (DBMS) + // product as identified by the client instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + // Note: The actual DBMS may differ from the one identified by the client. For + // example, when using PostgreSQL client libraries to connect to a CockroachDB, + // the `db.system.name` is set to `postgresql` based on the instrumentation's + // best knowledge. + DBSystemNameKey = attribute.Key("db.system.name") +) + +// DBClientConnectionPoolName returns an attribute KeyValue conforming to the +// "db.client.connection.pool.name" semantic conventions. It represents the name +// of the connection pool; unique within the instrumented application. In case +// the connection pool implementation doesn't provide a name, instrumentation +// SHOULD use a combination of parameters that would make the name unique, for +// example, combining attributes `server.address`, `server.port`, and +// `db.namespace`, formatted as `server.address:server.port/db.namespace`. +// Instrumentations that generate connection pool name following different +// patterns SHOULD document it. +func DBClientConnectionPoolName(val string) attribute.KeyValue { + return DBClientConnectionPoolNameKey.String(val) +} + +// DBCollectionName returns an attribute KeyValue conforming to the +// "db.collection.name" semantic conventions. It represents the name of a +// collection (table, container) within the database. +func DBCollectionName(val string) attribute.KeyValue { + return DBCollectionNameKey.String(val) +} + +// DBNamespace returns an attribute KeyValue conforming to the "db.namespace" +// semantic conventions. It represents the name of the database, fully qualified +// within the server address and port. +func DBNamespace(val string) attribute.KeyValue { + return DBNamespaceKey.String(val) +} + +// DBOperationBatchSize returns an attribute KeyValue conforming to the +// "db.operation.batch.size" semantic conventions. It represents the number of +// queries included in a batch operation. +func DBOperationBatchSize(val int) attribute.KeyValue { + return DBOperationBatchSizeKey.Int(val) +} + +// DBOperationName returns an attribute KeyValue conforming to the +// "db.operation.name" semantic conventions. It represents the name of the +// operation or command being executed. +func DBOperationName(val string) attribute.KeyValue { + return DBOperationNameKey.String(val) +} + +// DBQuerySummary returns an attribute KeyValue conforming to the +// "db.query.summary" semantic conventions. It represents the low cardinality +// summary of a database query. +func DBQuerySummary(val string) attribute.KeyValue { + return DBQuerySummaryKey.String(val) +} + +// DBQueryText returns an attribute KeyValue conforming to the "db.query.text" +// semantic conventions. It represents the database query being executed. +func DBQueryText(val string) attribute.KeyValue { + return DBQueryTextKey.String(val) +} + +// DBResponseReturnedRows returns an attribute KeyValue conforming to the +// "db.response.returned_rows" semantic conventions. It represents the number of +// rows returned by the operation. +func DBResponseReturnedRows(val int) attribute.KeyValue { + return DBResponseReturnedRowsKey.Int(val) +} + +// DBResponseStatusCode returns an attribute KeyValue conforming to the +// "db.response.status_code" semantic conventions. It represents the database +// response status code. +func DBResponseStatusCode(val string) attribute.KeyValue { + return DBResponseStatusCodeKey.String(val) +} + +// DBStoredProcedureName returns an attribute KeyValue conforming to the +// "db.stored_procedure.name" semantic conventions. It represents the name of a +// stored procedure within the database. +func DBStoredProcedureName(val string) attribute.KeyValue { + return DBStoredProcedureNameKey.String(val) +} + +// Enum values for db.client.connection.state +var ( + // idle + // Stability: development + DBClientConnectionStateIdle = DBClientConnectionStateKey.String("idle") + // used + // Stability: development + DBClientConnectionStateUsed = DBClientConnectionStateKey.String("used") +) + +// Enum values for db.system.name +var ( + // Some other SQL database. Fallback only. + // Stability: development + DBSystemNameOtherSQL = DBSystemNameKey.String("other_sql") + // [Adabas (Adaptable Database System)] + // Stability: development + // + // [Adabas (Adaptable Database System)]: https://documentation.softwareag.com/?pf=adabas + DBSystemNameSoftwareagAdabas = DBSystemNameKey.String("softwareag.adabas") + // [Actian Ingres] + // Stability: development + // + // [Actian Ingres]: https://www.actian.com/databases/ingres/ + DBSystemNameActianIngres = DBSystemNameKey.String("actian.ingres") + // [Amazon DynamoDB] + // Stability: development + // + // [Amazon DynamoDB]: https://aws.amazon.com/pm/dynamodb/ + DBSystemNameAWSDynamoDB = DBSystemNameKey.String("aws.dynamodb") + // [Amazon Redshift] + // Stability: development + // + // [Amazon Redshift]: https://aws.amazon.com/redshift/ + DBSystemNameAWSRedshift = DBSystemNameKey.String("aws.redshift") + // [Azure Cosmos DB] + // Stability: development + // + // [Azure Cosmos DB]: https://learn.microsoft.com/azure/cosmos-db + DBSystemNameAzureCosmosDB = DBSystemNameKey.String("azure.cosmosdb") + // [InterSystems Caché] + // Stability: development + // + // [InterSystems Caché]: https://www.intersystems.com/products/cache/ + DBSystemNameIntersystemsCache = DBSystemNameKey.String("intersystems.cache") + // [Apache Cassandra] + // Stability: development + // + // [Apache Cassandra]: https://cassandra.apache.org/ + DBSystemNameCassandra = DBSystemNameKey.String("cassandra") + // [ClickHouse] + // Stability: development + // + // [ClickHouse]: https://clickhouse.com/ + DBSystemNameClickHouse = DBSystemNameKey.String("clickhouse") + // [CockroachDB] + // Stability: development + // + // [CockroachDB]: https://www.cockroachlabs.com/ + DBSystemNameCockroachDB = DBSystemNameKey.String("cockroachdb") + // [Couchbase] + // Stability: development + // + // [Couchbase]: https://www.couchbase.com/ + DBSystemNameCouchbase = DBSystemNameKey.String("couchbase") + // [Apache CouchDB] + // Stability: development + // + // [Apache CouchDB]: https://couchdb.apache.org/ + DBSystemNameCouchDB = DBSystemNameKey.String("couchdb") + // [Apache Derby] + // Stability: development + // + // [Apache Derby]: https://db.apache.org/derby/ + DBSystemNameDerby = DBSystemNameKey.String("derby") + // [Elasticsearch] + // Stability: development + // + // [Elasticsearch]: https://www.elastic.co/elasticsearch + DBSystemNameElasticsearch = DBSystemNameKey.String("elasticsearch") + // [Firebird] + // Stability: development + // + // [Firebird]: https://www.firebirdsql.org/ + DBSystemNameFirebirdSQL = DBSystemNameKey.String("firebirdsql") + // [Google Cloud Spanner] + // Stability: development + // + // [Google Cloud Spanner]: https://cloud.google.com/spanner + DBSystemNameGCPSpanner = DBSystemNameKey.String("gcp.spanner") + // [Apache Geode] + // Stability: development + // + // [Apache Geode]: https://geode.apache.org/ + DBSystemNameGeode = DBSystemNameKey.String("geode") + // [H2 Database] + // Stability: development + // + // [H2 Database]: https://h2database.com/ + DBSystemNameH2database = DBSystemNameKey.String("h2database") + // [Apache HBase] + // Stability: development + // + // [Apache HBase]: https://hbase.apache.org/ + DBSystemNameHBase = DBSystemNameKey.String("hbase") + // [Apache Hive] + // Stability: development + // + // [Apache Hive]: https://hive.apache.org/ + DBSystemNameHive = DBSystemNameKey.String("hive") + // [HyperSQL Database] + // Stability: development + // + // [HyperSQL Database]: https://hsqldb.org/ + DBSystemNameHSQLDB = DBSystemNameKey.String("hsqldb") + // [IBM Db2] + // Stability: development + // + // [IBM Db2]: https://www.ibm.com/db2 + DBSystemNameIBMDB2 = DBSystemNameKey.String("ibm.db2") + // [IBM Informix] + // Stability: development + // + // [IBM Informix]: https://www.ibm.com/products/informix + DBSystemNameIBMInformix = DBSystemNameKey.String("ibm.informix") + // [IBM Netezza] + // Stability: development + // + // [IBM Netezza]: https://www.ibm.com/products/netezza + DBSystemNameIBMNetezza = DBSystemNameKey.String("ibm.netezza") + // [InfluxDB] + // Stability: development + // + // [InfluxDB]: https://www.influxdata.com/ + DBSystemNameInfluxDB = DBSystemNameKey.String("influxdb") + // [Instant] + // Stability: development + // + // [Instant]: https://www.instantdb.com/ + DBSystemNameInstantDB = DBSystemNameKey.String("instantdb") + // [MariaDB] + // Stability: stable + // + // [MariaDB]: https://mariadb.org/ + DBSystemNameMariaDB = DBSystemNameKey.String("mariadb") + // [Memcached] + // Stability: development + // + // [Memcached]: https://memcached.org/ + DBSystemNameMemcached = DBSystemNameKey.String("memcached") + // [MongoDB] + // Stability: development + // + // [MongoDB]: https://www.mongodb.com/ + DBSystemNameMongoDB = DBSystemNameKey.String("mongodb") + // [Microsoft SQL Server] + // Stability: stable + // + // [Microsoft SQL Server]: https://www.microsoft.com/sql-server + DBSystemNameMicrosoftSQLServer = DBSystemNameKey.String("microsoft.sql_server") + // [MySQL] + // Stability: stable + // + // [MySQL]: https://www.mysql.com/ + DBSystemNameMySQL = DBSystemNameKey.String("mysql") + // [Neo4j] + // Stability: development + // + // [Neo4j]: https://neo4j.com/ + DBSystemNameNeo4j = DBSystemNameKey.String("neo4j") + // [OpenSearch] + // Stability: development + // + // [OpenSearch]: https://opensearch.org/ + DBSystemNameOpenSearch = DBSystemNameKey.String("opensearch") + // [Oracle Database] + // Stability: development + // + // [Oracle Database]: https://www.oracle.com/database/ + DBSystemNameOracleDB = DBSystemNameKey.String("oracle.db") + // [PostgreSQL] + // Stability: stable + // + // [PostgreSQL]: https://www.postgresql.org/ + DBSystemNamePostgreSQL = DBSystemNameKey.String("postgresql") + // [Redis] + // Stability: development + // + // [Redis]: https://redis.io/ + DBSystemNameRedis = DBSystemNameKey.String("redis") + // [SAP HANA] + // Stability: development + // + // [SAP HANA]: https://www.sap.com/products/technology-platform/hana/what-is-sap-hana.html + DBSystemNameSAPHANA = DBSystemNameKey.String("sap.hana") + // [SAP MaxDB] + // Stability: development + // + // [SAP MaxDB]: https://maxdb.sap.com/ + DBSystemNameSAPMaxDB = DBSystemNameKey.String("sap.maxdb") + // [SQLite] + // Stability: development + // + // [SQLite]: https://www.sqlite.org/ + DBSystemNameSQLite = DBSystemNameKey.String("sqlite") + // [Teradata] + // Stability: development + // + // [Teradata]: https://www.teradata.com/ + DBSystemNameTeradata = DBSystemNameKey.String("teradata") + // [Trino] + // Stability: development + // + // [Trino]: https://trino.io/ + DBSystemNameTrino = DBSystemNameKey.String("trino") +) + +// Namespace: deployment +const ( + // DeploymentEnvironmentNameKey is the attribute Key conforming to the + // "deployment.environment.name" semantic conventions. It represents the name of + // the [deployment environment] (aka deployment tier). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "staging", "production" + // Note: `deployment.environment.name` does not affect the uniqueness + // constraints defined through + // the `service.namespace`, `service.name` and `service.instance.id` resource + // attributes. + // This implies that resources carrying the following attribute combinations + // MUST be + // considered to be identifying the same service: + // + // - `service.name=frontend`, `deployment.environment.name=production` + // - `service.name=frontend`, `deployment.environment.name=staging`. + // + // + // [deployment environment]: https://wikipedia.org/wiki/Deployment_environment + DeploymentEnvironmentNameKey = attribute.Key("deployment.environment.name") + + // DeploymentIDKey is the attribute Key conforming to the "deployment.id" + // semantic conventions. It represents the id of the deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1208" + DeploymentIDKey = attribute.Key("deployment.id") + + // DeploymentNameKey is the attribute Key conforming to the "deployment.name" + // semantic conventions. It represents the name of the deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "deploy my app", "deploy-frontend" + DeploymentNameKey = attribute.Key("deployment.name") + + // DeploymentStatusKey is the attribute Key conforming to the + // "deployment.status" semantic conventions. It represents the status of the + // deployment. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + DeploymentStatusKey = attribute.Key("deployment.status") +) + +// DeploymentEnvironmentName returns an attribute KeyValue conforming to the +// "deployment.environment.name" semantic conventions. It represents the name of +// the [deployment environment] (aka deployment tier). +// +// [deployment environment]: https://wikipedia.org/wiki/Deployment_environment +func DeploymentEnvironmentName(val string) attribute.KeyValue { + return DeploymentEnvironmentNameKey.String(val) +} + +// DeploymentID returns an attribute KeyValue conforming to the "deployment.id" +// semantic conventions. It represents the id of the deployment. +func DeploymentID(val string) attribute.KeyValue { + return DeploymentIDKey.String(val) +} + +// DeploymentName returns an attribute KeyValue conforming to the +// "deployment.name" semantic conventions. It represents the name of the +// deployment. +func DeploymentName(val string) attribute.KeyValue { + return DeploymentNameKey.String(val) +} + +// Enum values for deployment.status +var ( + // failed + // Stability: development + DeploymentStatusFailed = DeploymentStatusKey.String("failed") + // succeeded + // Stability: development + DeploymentStatusSucceeded = DeploymentStatusKey.String("succeeded") +) + +// Namespace: destination +const ( + // DestinationAddressKey is the attribute Key conforming to the + // "destination.address" semantic conventions. It represents the destination + // address - domain name if available without reverse DNS lookup; otherwise, IP + // address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "destination.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the source side, and when communicating through an + // intermediary, `destination.address` SHOULD represent the destination address + // behind any intermediaries, for example proxies, if it's available. + DestinationAddressKey = attribute.Key("destination.address") + + // DestinationPortKey is the attribute Key conforming to the "destination.port" + // semantic conventions. It represents the destination port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3389, 2888 + DestinationPortKey = attribute.Key("destination.port") +) + +// DestinationAddress returns an attribute KeyValue conforming to the +// "destination.address" semantic conventions. It represents the destination +// address - domain name if available without reverse DNS lookup; otherwise, IP +// address or Unix domain socket name. +func DestinationAddress(val string) attribute.KeyValue { + return DestinationAddressKey.String(val) +} + +// DestinationPort returns an attribute KeyValue conforming to the +// "destination.port" semantic conventions. It represents the destination port +// number. +func DestinationPort(val int) attribute.KeyValue { + return DestinationPortKey.Int(val) +} + +// Namespace: device +const ( + // DeviceIDKey is the attribute Key conforming to the "device.id" semantic + // conventions. It represents a unique identifier representing the device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123456789012345", "01:23:45:67:89:AB" + // Note: Its value SHOULD be identical for all apps on a device and it SHOULD + // NOT change if an app is uninstalled and re-installed. + // However, it might be resettable by the user for all apps on a device. + // Hardware IDs (e.g. vendor-specific serial number, IMEI or MAC address) MAY be + // used as values. + // + // More information about Android identifier best practices can be found [here] + // . + // + // > [!WARNING]> This attribute may contain sensitive (PII) information. Caution + // > should be taken when storing personal data or anything which can identify a + // > user. GDPR and data protection laws may apply, + // > ensure you do your own due diligence.> Due to these reasons, this + // > identifier is not recommended for consumer applications and will likely + // > result in rejection from both Google Play and App Store. + // > However, it may be appropriate for specific enterprise scenarios, such as + // > kiosk devices or enterprise-managed devices, with appropriate compliance + // > clearance. + // > Any instrumentation providing this identifier MUST implement it as an + // > opt-in feature.> See [`app.installation.id`]> for a more + // > privacy-preserving alternative. + // + // [here]: https://developer.android.com/training/articles/user-data-ids + // [`app.installation.id`]: /docs/registry/attributes/app.md#app-installation-id + DeviceIDKey = attribute.Key("device.id") + + // DeviceManufacturerKey is the attribute Key conforming to the + // "device.manufacturer" semantic conventions. It represents the name of the + // device manufacturer. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Apple", "Samsung" + // Note: The Android OS provides this field via [Build]. iOS apps SHOULD + // hardcode the value `Apple`. + // + // [Build]: https://developer.android.com/reference/android/os/Build#MANUFACTURER + DeviceManufacturerKey = attribute.Key("device.manufacturer") + + // DeviceModelIdentifierKey is the attribute Key conforming to the + // "device.model.identifier" semantic conventions. It represents the model + // identifier for the device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iPhone3,4", "SM-G920F" + // Note: It's recommended this value represents a machine-readable version of + // the model identifier rather than the market or consumer-friendly name of the + // device. + DeviceModelIdentifierKey = attribute.Key("device.model.identifier") + + // DeviceModelNameKey is the attribute Key conforming to the "device.model.name" + // semantic conventions. It represents the marketing name for the device model. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iPhone 6s Plus", "Samsung Galaxy S6" + // Note: It's recommended this value represents a human-readable version of the + // device model rather than a machine-readable alternative. + DeviceModelNameKey = attribute.Key("device.model.name") +) + +// DeviceID returns an attribute KeyValue conforming to the "device.id" semantic +// conventions. It represents a unique identifier representing the device. +func DeviceID(val string) attribute.KeyValue { + return DeviceIDKey.String(val) +} + +// DeviceManufacturer returns an attribute KeyValue conforming to the +// "device.manufacturer" semantic conventions. It represents the name of the +// device manufacturer. +func DeviceManufacturer(val string) attribute.KeyValue { + return DeviceManufacturerKey.String(val) +} + +// DeviceModelIdentifier returns an attribute KeyValue conforming to the +// "device.model.identifier" semantic conventions. It represents the model +// identifier for the device. +func DeviceModelIdentifier(val string) attribute.KeyValue { + return DeviceModelIdentifierKey.String(val) +} + +// DeviceModelName returns an attribute KeyValue conforming to the +// "device.model.name" semantic conventions. It represents the marketing name for +// the device model. +func DeviceModelName(val string) attribute.KeyValue { + return DeviceModelNameKey.String(val) +} + +// Namespace: disk +const ( + // DiskIODirectionKey is the attribute Key conforming to the "disk.io.direction" + // semantic conventions. It represents the disk IO operation direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "read" + DiskIODirectionKey = attribute.Key("disk.io.direction") +) + +// Enum values for disk.io.direction +var ( + // read + // Stability: development + DiskIODirectionRead = DiskIODirectionKey.String("read") + // write + // Stability: development + DiskIODirectionWrite = DiskIODirectionKey.String("write") +) + +// Namespace: dns +const ( + // DNSQuestionNameKey is the attribute Key conforming to the "dns.question.name" + // semantic conventions. It represents the name being queried. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "www.example.com", "opentelemetry.io" + // Note: If the name field contains non-printable characters (below 32 or above + // 126), those characters should be represented as escaped base 10 integers + // (\DDD). Back slashes and quotes should be escaped. Tabs, carriage returns, + // and line feeds should be converted to \t, \r, and \n respectively. + DNSQuestionNameKey = attribute.Key("dns.question.name") +) + +// DNSQuestionName returns an attribute KeyValue conforming to the +// "dns.question.name" semantic conventions. It represents the name being +// queried. +func DNSQuestionName(val string) attribute.KeyValue { + return DNSQuestionNameKey.String(val) +} + +// Namespace: elasticsearch +const ( + // ElasticsearchNodeNameKey is the attribute Key conforming to the + // "elasticsearch.node.name" semantic conventions. It represents the represents + // the human-readable identifier of the node/instance to which a request was + // routed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "instance-0000000001" + ElasticsearchNodeNameKey = attribute.Key("elasticsearch.node.name") +) + +// ElasticsearchNodeName returns an attribute KeyValue conforming to the +// "elasticsearch.node.name" semantic conventions. It represents the represents +// the human-readable identifier of the node/instance to which a request was +// routed. +func ElasticsearchNodeName(val string) attribute.KeyValue { + return ElasticsearchNodeNameKey.String(val) +} + +// Namespace: enduser +const ( + // EnduserIDKey is the attribute Key conforming to the "enduser.id" semantic + // conventions. It represents the unique identifier of an end user in the + // system. It maybe a username, email address, or other identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "username" + // Note: Unique identifier of an end user in the system. + // + // > [!Warning] + // > This field contains sensitive (PII) information. + EnduserIDKey = attribute.Key("enduser.id") + + // EnduserPseudoIDKey is the attribute Key conforming to the "enduser.pseudo.id" + // semantic conventions. It represents the pseudonymous identifier of an end + // user. This identifier should be a random value that is not directly linked or + // associated with the end user's actual identity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "QdH5CAWJgqVT4rOr0qtumf" + // Note: Pseudonymous identifier of an end user. + // + // > [!Warning] + // > This field contains sensitive (linkable PII) information. + EnduserPseudoIDKey = attribute.Key("enduser.pseudo.id") +) + +// EnduserID returns an attribute KeyValue conforming to the "enduser.id" +// semantic conventions. It represents the unique identifier of an end user in +// the system. It maybe a username, email address, or other identifier. +func EnduserID(val string) attribute.KeyValue { + return EnduserIDKey.String(val) +} + +// EnduserPseudoID returns an attribute KeyValue conforming to the +// "enduser.pseudo.id" semantic conventions. It represents the pseudonymous +// identifier of an end user. This identifier should be a random value that is +// not directly linked or associated with the end user's actual identity. +func EnduserPseudoID(val string) attribute.KeyValue { + return EnduserPseudoIDKey.String(val) +} + +// Namespace: error +const ( + // ErrorMessageKey is the attribute Key conforming to the "error.message" + // semantic conventions. It represents a message providing more detail about an + // error in human-readable form. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Unexpected input type: string", "The user has exceeded their + // storage quota" + // Note: `error.message` should provide additional context and detail about an + // error. + // It is NOT RECOMMENDED to duplicate the value of `error.type` in + // `error.message`. + // It is also NOT RECOMMENDED to duplicate the value of `exception.message` in + // `error.message`. + // + // `error.message` is NOT RECOMMENDED for metrics or spans due to its unbounded + // cardinality and overlap with span status. + ErrorMessageKey = attribute.Key("error.message") + + // ErrorTypeKey is the attribute Key conforming to the "error.type" semantic + // conventions. It represents the describes a class of error the operation ended + // with. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "timeout", "java.net.UnknownHostException", + // "server_certificate_invalid", "500" + // Note: The `error.type` SHOULD be predictable, and SHOULD have low + // cardinality. + // + // When `error.type` is set to a type (e.g., an exception type), its + // canonical class name identifying the type within the artifact SHOULD be used. + // + // Instrumentations SHOULD document the list of errors they report. + // + // The cardinality of `error.type` within one instrumentation library SHOULD be + // low. + // Telemetry consumers that aggregate data from multiple instrumentation + // libraries and applications + // should be prepared for `error.type` to have high cardinality at query time + // when no + // additional filters are applied. + // + // If the operation has completed successfully, instrumentations SHOULD NOT set + // `error.type`. + // + // If a specific domain defines its own set of error identifiers (such as HTTP + // or gRPC status codes), + // it's RECOMMENDED to: + // + // - Use a domain-specific attribute + // - Set `error.type` to capture all errors, regardless of whether they are + // defined within the domain-specific set or not. + ErrorTypeKey = attribute.Key("error.type") +) + +// ErrorMessage returns an attribute KeyValue conforming to the "error.message" +// semantic conventions. It represents a message providing more detail about an +// error in human-readable form. +func ErrorMessage(val string) attribute.KeyValue { + return ErrorMessageKey.String(val) +} + +// Enum values for error.type +var ( + // A fallback error value to be used when the instrumentation doesn't define a + // custom value. + // + // Stability: stable + ErrorTypeOther = ErrorTypeKey.String("_OTHER") +) + +// Namespace: exception +const ( + // ExceptionMessageKey is the attribute Key conforming to the + // "exception.message" semantic conventions. It represents the exception + // message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "Division by zero", "Can't convert 'int' object to str implicitly" + ExceptionMessageKey = attribute.Key("exception.message") + + // ExceptionStacktraceKey is the attribute Key conforming to the + // "exception.stacktrace" semantic conventions. It represents a stacktrace as a + // string in the natural representation for the language runtime. The + // representation is to be determined and documented by each language SIG. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: Exception in thread "main" java.lang.RuntimeException: Test + // exception\n at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at + // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at + // com.example.GenerateTrace.main(GenerateTrace.java:5) + ExceptionStacktraceKey = attribute.Key("exception.stacktrace") + + // ExceptionTypeKey is the attribute Key conforming to the "exception.type" + // semantic conventions. It represents the type of the exception (its + // fully-qualified class name, if applicable). The dynamic type of the exception + // should be preferred over the static type in languages that support it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "java.net.ConnectException", "OSError" + ExceptionTypeKey = attribute.Key("exception.type") +) + +// ExceptionMessage returns an attribute KeyValue conforming to the +// "exception.message" semantic conventions. It represents the exception message. +func ExceptionMessage(val string) attribute.KeyValue { + return ExceptionMessageKey.String(val) +} + +// ExceptionStacktrace returns an attribute KeyValue conforming to the +// "exception.stacktrace" semantic conventions. It represents a stacktrace as a +// string in the natural representation for the language runtime. The +// representation is to be determined and documented by each language SIG. +func ExceptionStacktrace(val string) attribute.KeyValue { + return ExceptionStacktraceKey.String(val) +} + +// ExceptionType returns an attribute KeyValue conforming to the "exception.type" +// semantic conventions. It represents the type of the exception (its +// fully-qualified class name, if applicable). The dynamic type of the exception +// should be preferred over the static type in languages that support it. +func ExceptionType(val string) attribute.KeyValue { + return ExceptionTypeKey.String(val) +} + +// Namespace: faas +const ( + // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart" + // semantic conventions. It represents a boolean that is true if the serverless + // function is executed for the first time (aka cold-start). + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSColdstartKey = attribute.Key("faas.coldstart") + + // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic + // conventions. It represents a string containing the schedule period as + // [Cron Expression]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0/5 * * * ? * + // + // [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm + FaaSCronKey = attribute.Key("faas.cron") + + // FaaSDocumentCollectionKey is the attribute Key conforming to the + // "faas.document.collection" semantic conventions. It represents the name of + // the source on which the triggering operation was performed. For example, in + // Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the + // database name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myBucketName", "myDbName" + FaaSDocumentCollectionKey = attribute.Key("faas.document.collection") + + // FaaSDocumentNameKey is the attribute Key conforming to the + // "faas.document.name" semantic conventions. It represents the document + // name/table subjected to the operation. For example, in Cloud Storage or S3 is + // the name of the file, and in Cosmos DB the table name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myFile.txt", "myTableName" + FaaSDocumentNameKey = attribute.Key("faas.document.name") + + // FaaSDocumentOperationKey is the attribute Key conforming to the + // "faas.document.operation" semantic conventions. It represents the describes + // the type of the operation that was performed on the data. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSDocumentOperationKey = attribute.Key("faas.document.operation") + + // FaaSDocumentTimeKey is the attribute Key conforming to the + // "faas.document.time" semantic conventions. It represents a string containing + // the time when the data was accessed in the [ISO 8601] format expressed in + // [UTC]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 2020-01-23T13:47:06Z + // + // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html + // [UTC]: https://www.w3.org/TR/NOTE-datetime + FaaSDocumentTimeKey = attribute.Key("faas.document.time") + + // FaaSInstanceKey is the attribute Key conforming to the "faas.instance" + // semantic conventions. It represents the execution environment ID as a string, + // that will be potentially reused for other invocations to the same + // function/function version. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021/06/28/[$LATEST]2f399eb14537447da05ab2a2e39309de" + // Note: - **AWS Lambda:** Use the (full) log stream name. + FaaSInstanceKey = attribute.Key("faas.instance") + + // FaaSInvocationIDKey is the attribute Key conforming to the + // "faas.invocation_id" semantic conventions. It represents the invocation ID of + // the current function invocation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: af9d5aa4-a685-4c5f-a22b-444f80b3cc28 + FaaSInvocationIDKey = attribute.Key("faas.invocation_id") + + // FaaSInvokedNameKey is the attribute Key conforming to the "faas.invoked_name" + // semantic conventions. It represents the name of the invoked function. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: my-function + // Note: SHOULD be equal to the `faas.name` resource attribute of the invoked + // function. + FaaSInvokedNameKey = attribute.Key("faas.invoked_name") + + // FaaSInvokedProviderKey is the attribute Key conforming to the + // "faas.invoked_provider" semantic conventions. It represents the cloud + // provider of the invoked function. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: SHOULD be equal to the `cloud.provider` resource attribute of the + // invoked function. + FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider") + + // FaaSInvokedRegionKey is the attribute Key conforming to the + // "faas.invoked_region" semantic conventions. It represents the cloud region of + // the invoked function. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: eu-central-1 + // Note: SHOULD be equal to the `cloud.region` resource attribute of the invoked + // function. + FaaSInvokedRegionKey = attribute.Key("faas.invoked_region") + + // FaaSMaxMemoryKey is the attribute Key conforming to the "faas.max_memory" + // semantic conventions. It represents the amount of memory available to the + // serverless function converted to Bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: It's recommended to set this attribute since e.g. too little memory can + // easily stop a Java AWS Lambda function from working correctly. On AWS Lambda, + // the environment variable `AWS_LAMBDA_FUNCTION_MEMORY_SIZE` provides this + // information (which must be multiplied by 1,048,576). + FaaSMaxMemoryKey = attribute.Key("faas.max_memory") + + // FaaSNameKey is the attribute Key conforming to the "faas.name" semantic + // conventions. It represents the name of the single function that this runtime + // instance executes. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-function", "myazurefunctionapp/some-function-name" + // Note: This is the name of the function as configured/deployed on the FaaS + // platform and is usually different from the name of the callback + // function (which may be stored in the + // [`code.namespace`/`code.function.name`] + // span attributes). + // + // For some cloud providers, the above definition is ambiguous. The following + // definition of function name MUST be used for this attribute + // (and consequently the span name) for the listed cloud providers/products: + // + // - **Azure:** The full name `/`, i.e., function app name + // followed by a forward slash followed by the function name (this form + // can also be seen in the resource JSON for the function). + // This means that a span attribute MUST be used, as an Azure function + // app can host multiple functions that would usually share + // a TracerProvider (see also the `cloud.resource_id` attribute). + // + // + // [`code.namespace`/`code.function.name`]: /docs/general/attributes.md#source-code-attributes + FaaSNameKey = attribute.Key("faas.name") + + // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic + // conventions. It represents a string containing the function invocation time + // in the [ISO 8601] format expressed in [UTC]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 2020-01-23T13:47:06Z + // + // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html + // [UTC]: https://www.w3.org/TR/NOTE-datetime + FaaSTimeKey = attribute.Key("faas.time") + + // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger" semantic + // conventions. It represents the type of the trigger which caused this function + // invocation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSTriggerKey = attribute.Key("faas.trigger") + + // FaaSVersionKey is the attribute Key conforming to the "faas.version" semantic + // conventions. It represents the immutable version of the function being + // executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "26", "pinkfroid-00002" + // Note: Depending on the cloud provider and platform, use: + // + // - **AWS Lambda:** The [function version] + // (an integer represented as a decimal string). + // - **Google Cloud Run (Services):** The [revision] + // (i.e., the function name plus the revision suffix). + // - **Google Cloud Functions:** The value of the + // [`K_REVISION` environment variable]. + // - **Azure Functions:** Not applicable. Do not set this attribute. + // + // + // [function version]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-versions.html + // [revision]: https://cloud.google.com/run/docs/managing/revisions + // [`K_REVISION` environment variable]: https://cloud.google.com/functions/docs/env-var#runtime_environment_variables_set_automatically + FaaSVersionKey = attribute.Key("faas.version") +) + +// FaaSColdstart returns an attribute KeyValue conforming to the "faas.coldstart" +// semantic conventions. It represents a boolean that is true if the serverless +// function is executed for the first time (aka cold-start). +func FaaSColdstart(val bool) attribute.KeyValue { + return FaaSColdstartKey.Bool(val) +} + +// FaaSCron returns an attribute KeyValue conforming to the "faas.cron" semantic +// conventions. It represents a string containing the schedule period as +// [Cron Expression]. +// +// [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm +func FaaSCron(val string) attribute.KeyValue { + return FaaSCronKey.String(val) +} + +// FaaSDocumentCollection returns an attribute KeyValue conforming to the +// "faas.document.collection" semantic conventions. It represents the name of the +// source on which the triggering operation was performed. For example, in Cloud +// Storage or S3 corresponds to the bucket name, and in Cosmos DB to the database +// name. +func FaaSDocumentCollection(val string) attribute.KeyValue { + return FaaSDocumentCollectionKey.String(val) +} + +// FaaSDocumentName returns an attribute KeyValue conforming to the +// "faas.document.name" semantic conventions. It represents the document +// name/table subjected to the operation. For example, in Cloud Storage or S3 is +// the name of the file, and in Cosmos DB the table name. +func FaaSDocumentName(val string) attribute.KeyValue { + return FaaSDocumentNameKey.String(val) +} + +// FaaSDocumentTime returns an attribute KeyValue conforming to the +// "faas.document.time" semantic conventions. It represents a string containing +// the time when the data was accessed in the [ISO 8601] format expressed in +// [UTC]. +// +// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html +// [UTC]: https://www.w3.org/TR/NOTE-datetime +func FaaSDocumentTime(val string) attribute.KeyValue { + return FaaSDocumentTimeKey.String(val) +} + +// FaaSInstance returns an attribute KeyValue conforming to the "faas.instance" +// semantic conventions. It represents the execution environment ID as a string, +// that will be potentially reused for other invocations to the same +// function/function version. +func FaaSInstance(val string) attribute.KeyValue { + return FaaSInstanceKey.String(val) +} + +// FaaSInvocationID returns an attribute KeyValue conforming to the +// "faas.invocation_id" semantic conventions. It represents the invocation ID of +// the current function invocation. +func FaaSInvocationID(val string) attribute.KeyValue { + return FaaSInvocationIDKey.String(val) +} + +// FaaSInvokedName returns an attribute KeyValue conforming to the +// "faas.invoked_name" semantic conventions. It represents the name of the +// invoked function. +func FaaSInvokedName(val string) attribute.KeyValue { + return FaaSInvokedNameKey.String(val) +} + +// FaaSInvokedRegion returns an attribute KeyValue conforming to the +// "faas.invoked_region" semantic conventions. It represents the cloud region of +// the invoked function. +func FaaSInvokedRegion(val string) attribute.KeyValue { + return FaaSInvokedRegionKey.String(val) +} + +// FaaSMaxMemory returns an attribute KeyValue conforming to the +// "faas.max_memory" semantic conventions. It represents the amount of memory +// available to the serverless function converted to Bytes. +func FaaSMaxMemory(val int) attribute.KeyValue { + return FaaSMaxMemoryKey.Int(val) +} + +// FaaSName returns an attribute KeyValue conforming to the "faas.name" semantic +// conventions. It represents the name of the single function that this runtime +// instance executes. +func FaaSName(val string) attribute.KeyValue { + return FaaSNameKey.String(val) +} + +// FaaSTime returns an attribute KeyValue conforming to the "faas.time" semantic +// conventions. It represents a string containing the function invocation time in +// the [ISO 8601] format expressed in [UTC]. +// +// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html +// [UTC]: https://www.w3.org/TR/NOTE-datetime +func FaaSTime(val string) attribute.KeyValue { + return FaaSTimeKey.String(val) +} + +// FaaSVersion returns an attribute KeyValue conforming to the "faas.version" +// semantic conventions. It represents the immutable version of the function +// being executed. +func FaaSVersion(val string) attribute.KeyValue { + return FaaSVersionKey.String(val) +} + +// Enum values for faas.document.operation +var ( + // When a new object is created. + // Stability: development + FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert") + // When an object is modified. + // Stability: development + FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit") + // When an object is deleted. + // Stability: development + FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete") +) + +// Enum values for faas.invoked_provider +var ( + // Alibaba Cloud + // Stability: development + FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud") + // Amazon Web Services + // Stability: development + FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws") + // Microsoft Azure + // Stability: development + FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure") + // Google Cloud Platform + // Stability: development + FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp") + // Tencent Cloud + // Stability: development + FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud") +) + +// Enum values for faas.trigger +var ( + // A response to some data source operation such as a database or filesystem + // read/write + // Stability: development + FaaSTriggerDatasource = FaaSTriggerKey.String("datasource") + // To provide an answer to an inbound HTTP request + // Stability: development + FaaSTriggerHTTP = FaaSTriggerKey.String("http") + // A function is set to be executed when messages are sent to a messaging system + // Stability: development + FaaSTriggerPubSub = FaaSTriggerKey.String("pubsub") + // A function is scheduled to be executed regularly + // Stability: development + FaaSTriggerTimer = FaaSTriggerKey.String("timer") + // If none of the others apply + // Stability: development + FaaSTriggerOther = FaaSTriggerKey.String("other") +) + +// Namespace: feature_flag +const ( + // FeatureFlagContextIDKey is the attribute Key conforming to the + // "feature_flag.context.id" semantic conventions. It represents the unique + // identifier for the flag evaluation context. For example, the targeting key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "5157782b-2203-4c80-a857-dbbd5e7761db" + FeatureFlagContextIDKey = attribute.Key("feature_flag.context.id") + + // FeatureFlagKeyKey is the attribute Key conforming to the "feature_flag.key" + // semantic conventions. It represents the lookup key of the feature flag. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "logo-color" + FeatureFlagKeyKey = attribute.Key("feature_flag.key") + + // FeatureFlagProviderNameKey is the attribute Key conforming to the + // "feature_flag.provider.name" semantic conventions. It represents the + // identifies the feature flag provider. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Flag Manager" + FeatureFlagProviderNameKey = attribute.Key("feature_flag.provider.name") + + // FeatureFlagResultReasonKey is the attribute Key conforming to the + // "feature_flag.result.reason" semantic conventions. It represents the reason + // code which shows how a feature flag value was determined. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "static", "targeting_match", "error", "default" + FeatureFlagResultReasonKey = attribute.Key("feature_flag.result.reason") + + // FeatureFlagResultValueKey is the attribute Key conforming to the + // "feature_flag.result.value" semantic conventions. It represents the evaluated + // value of the feature flag. + // + // Type: any + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "#ff0000", true, 3 + // Note: With some feature flag providers, feature flag results can be quite + // large or contain private or sensitive details. + // Because of this, `feature_flag.result.variant` is often the preferred + // attribute if it is available. + // + // It may be desirable to redact or otherwise limit the size and scope of + // `feature_flag.result.value` if possible. + // Because the evaluated flag value is unstructured and may be any type, it is + // left to the instrumentation author to determine how best to achieve this. + FeatureFlagResultValueKey = attribute.Key("feature_flag.result.value") + + // FeatureFlagResultVariantKey is the attribute Key conforming to the + // "feature_flag.result.variant" semantic conventions. It represents a semantic + // identifier for an evaluated flag value. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "red", "true", "on" + // Note: A semantic identifier, commonly referred to as a variant, provides a + // means + // for referring to a value without including the value itself. This can + // provide additional context for understanding the meaning behind a value. + // For example, the variant `red` maybe be used for the value `#c05543`. + FeatureFlagResultVariantKey = attribute.Key("feature_flag.result.variant") + + // FeatureFlagSetIDKey is the attribute Key conforming to the + // "feature_flag.set.id" semantic conventions. It represents the identifier of + // the [flag set] to which the feature flag belongs. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "proj-1", "ab98sgs", "service1/dev" + // + // [flag set]: https://openfeature.dev/specification/glossary/#flag-set + FeatureFlagSetIDKey = attribute.Key("feature_flag.set.id") + + // FeatureFlagVersionKey is the attribute Key conforming to the + // "feature_flag.version" semantic conventions. It represents the version of the + // ruleset used during the evaluation. This may be any stable value which + // uniquely identifies the ruleset. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1", "01ABCDEF" + FeatureFlagVersionKey = attribute.Key("feature_flag.version") +) + +// FeatureFlagContextID returns an attribute KeyValue conforming to the +// "feature_flag.context.id" semantic conventions. It represents the unique +// identifier for the flag evaluation context. For example, the targeting key. +func FeatureFlagContextID(val string) attribute.KeyValue { + return FeatureFlagContextIDKey.String(val) +} + +// FeatureFlagKey returns an attribute KeyValue conforming to the +// "feature_flag.key" semantic conventions. It represents the lookup key of the +// feature flag. +func FeatureFlagKey(val string) attribute.KeyValue { + return FeatureFlagKeyKey.String(val) +} + +// FeatureFlagProviderName returns an attribute KeyValue conforming to the +// "feature_flag.provider.name" semantic conventions. It represents the +// identifies the feature flag provider. +func FeatureFlagProviderName(val string) attribute.KeyValue { + return FeatureFlagProviderNameKey.String(val) +} + +// FeatureFlagResultVariant returns an attribute KeyValue conforming to the +// "feature_flag.result.variant" semantic conventions. It represents a semantic +// identifier for an evaluated flag value. +func FeatureFlagResultVariant(val string) attribute.KeyValue { + return FeatureFlagResultVariantKey.String(val) +} + +// FeatureFlagSetID returns an attribute KeyValue conforming to the +// "feature_flag.set.id" semantic conventions. It represents the identifier of +// the [flag set] to which the feature flag belongs. +// +// [flag set]: https://openfeature.dev/specification/glossary/#flag-set +func FeatureFlagSetID(val string) attribute.KeyValue { + return FeatureFlagSetIDKey.String(val) +} + +// FeatureFlagVersion returns an attribute KeyValue conforming to the +// "feature_flag.version" semantic conventions. It represents the version of the +// ruleset used during the evaluation. This may be any stable value which +// uniquely identifies the ruleset. +func FeatureFlagVersion(val string) attribute.KeyValue { + return FeatureFlagVersionKey.String(val) +} + +// Enum values for feature_flag.result.reason +var ( + // The resolved value is static (no dynamic evaluation). + // Stability: development + FeatureFlagResultReasonStatic = FeatureFlagResultReasonKey.String("static") + // The resolved value fell back to a pre-configured value (no dynamic evaluation + // occurred or dynamic evaluation yielded no result). + // Stability: development + FeatureFlagResultReasonDefault = FeatureFlagResultReasonKey.String("default") + // The resolved value was the result of a dynamic evaluation, such as a rule or + // specific user-targeting. + // Stability: development + FeatureFlagResultReasonTargetingMatch = FeatureFlagResultReasonKey.String("targeting_match") + // The resolved value was the result of pseudorandom assignment. + // Stability: development + FeatureFlagResultReasonSplit = FeatureFlagResultReasonKey.String("split") + // The resolved value was retrieved from cache. + // Stability: development + FeatureFlagResultReasonCached = FeatureFlagResultReasonKey.String("cached") + // The resolved value was the result of the flag being disabled in the + // management system. + // Stability: development + FeatureFlagResultReasonDisabled = FeatureFlagResultReasonKey.String("disabled") + // The reason for the resolved value could not be determined. + // Stability: development + FeatureFlagResultReasonUnknown = FeatureFlagResultReasonKey.String("unknown") + // The resolved value is non-authoritative or possibly out of date + // Stability: development + FeatureFlagResultReasonStale = FeatureFlagResultReasonKey.String("stale") + // The resolved value was the result of an error. + // Stability: development + FeatureFlagResultReasonError = FeatureFlagResultReasonKey.String("error") +) + +// Namespace: file +const ( + // FileAccessedKey is the attribute Key conforming to the "file.accessed" + // semantic conventions. It represents the time when the file was last accessed, + // in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: This attribute might not be supported by some file systems — NFS, + // FAT32, in embedded OS, etc. + FileAccessedKey = attribute.Key("file.accessed") + + // FileAttributesKey is the attribute Key conforming to the "file.attributes" + // semantic conventions. It represents the array of file attributes. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "readonly", "hidden" + // Note: Attributes names depend on the OS or file system. Here’s a + // non-exhaustive list of values expected for this attribute: `archive`, + // `compressed`, `directory`, `encrypted`, `execute`, `hidden`, `immutable`, + // `journaled`, `read`, `readonly`, `symbolic link`, `system`, `temporary`, + // `write`. + FileAttributesKey = attribute.Key("file.attributes") + + // FileChangedKey is the attribute Key conforming to the "file.changed" semantic + // conventions. It represents the time when the file attributes or metadata was + // last changed, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: `file.changed` captures the time when any of the file's properties or + // attributes (including the content) are changed, while `file.modified` + // captures the timestamp when the file content is modified. + FileChangedKey = attribute.Key("file.changed") + + // FileCreatedKey is the attribute Key conforming to the "file.created" semantic + // conventions. It represents the time when the file was created, in ISO 8601 + // format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: This attribute might not be supported by some file systems — NFS, + // FAT32, in embedded OS, etc. + FileCreatedKey = attribute.Key("file.created") + + // FileDirectoryKey is the attribute Key conforming to the "file.directory" + // semantic conventions. It represents the directory where the file is located. + // It should include the drive letter, when appropriate. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/home/user", "C:\Program Files\MyApp" + FileDirectoryKey = attribute.Key("file.directory") + + // FileExtensionKey is the attribute Key conforming to the "file.extension" + // semantic conventions. It represents the file extension, excluding the leading + // dot. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "png", "gz" + // Note: When the file name has multiple extensions (example.tar.gz), only the + // last one should be captured ("gz", not "tar.gz"). + FileExtensionKey = attribute.Key("file.extension") + + // FileForkNameKey is the attribute Key conforming to the "file.fork_name" + // semantic conventions. It represents the name of the fork. A fork is + // additional data associated with a filesystem object. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Zone.Identifer" + // Note: On Linux, a resource fork is used to store additional data with a + // filesystem object. A file always has at least one fork for the data portion, + // and additional forks may exist. + // On NTFS, this is analogous to an Alternate Data Stream (ADS), and the default + // data stream for a file is just called $DATA. Zone.Identifier is commonly used + // by Windows to track contents downloaded from the Internet. An ADS is + // typically of the form: C:\path\to\filename.extension:some_fork_name, and + // some_fork_name is the value that should populate `fork_name`. + // `filename.extension` should populate `file.name`, and `extension` should + // populate `file.extension`. The full path, `file.path`, will include the fork + // name. + FileForkNameKey = attribute.Key("file.fork_name") + + // FileGroupIDKey is the attribute Key conforming to the "file.group.id" + // semantic conventions. It represents the primary Group ID (GID) of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1000" + FileGroupIDKey = attribute.Key("file.group.id") + + // FileGroupNameKey is the attribute Key conforming to the "file.group.name" + // semantic conventions. It represents the primary group name of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "users" + FileGroupNameKey = attribute.Key("file.group.name") + + // FileInodeKey is the attribute Key conforming to the "file.inode" semantic + // conventions. It represents the inode representing the file in the filesystem. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "256383" + FileInodeKey = attribute.Key("file.inode") + + // FileModeKey is the attribute Key conforming to the "file.mode" semantic + // conventions. It represents the mode of the file in octal representation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0640" + FileModeKey = attribute.Key("file.mode") + + // FileModifiedKey is the attribute Key conforming to the "file.modified" + // semantic conventions. It represents the time when the file content was last + // modified, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + FileModifiedKey = attribute.Key("file.modified") + + // FileNameKey is the attribute Key conforming to the "file.name" semantic + // conventions. It represents the name of the file including the extension, + // without the directory. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "example.png" + FileNameKey = attribute.Key("file.name") + + // FileOwnerIDKey is the attribute Key conforming to the "file.owner.id" + // semantic conventions. It represents the user ID (UID) or security identifier + // (SID) of the file owner. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1000" + FileOwnerIDKey = attribute.Key("file.owner.id") + + // FileOwnerNameKey is the attribute Key conforming to the "file.owner.name" + // semantic conventions. It represents the username of the file owner. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + FileOwnerNameKey = attribute.Key("file.owner.name") + + // FilePathKey is the attribute Key conforming to the "file.path" semantic + // conventions. It represents the full path to the file, including the file + // name. It should include the drive letter, when appropriate. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/home/alice/example.png", "C:\Program Files\MyApp\myapp.exe" + FilePathKey = attribute.Key("file.path") + + // FileSizeKey is the attribute Key conforming to the "file.size" semantic + // conventions. It represents the file size in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FileSizeKey = attribute.Key("file.size") + + // FileSymbolicLinkTargetPathKey is the attribute Key conforming to the + // "file.symbolic_link.target_path" semantic conventions. It represents the path + // to the target of a symbolic link. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/usr/bin/python3" + // Note: This attribute is only applicable to symbolic links. + FileSymbolicLinkTargetPathKey = attribute.Key("file.symbolic_link.target_path") +) + +// FileAccessed returns an attribute KeyValue conforming to the "file.accessed" +// semantic conventions. It represents the time when the file was last accessed, +// in ISO 8601 format. +func FileAccessed(val string) attribute.KeyValue { + return FileAccessedKey.String(val) +} + +// FileAttributes returns an attribute KeyValue conforming to the +// "file.attributes" semantic conventions. It represents the array of file +// attributes. +func FileAttributes(val ...string) attribute.KeyValue { + return FileAttributesKey.StringSlice(val) +} + +// FileChanged returns an attribute KeyValue conforming to the "file.changed" +// semantic conventions. It represents the time when the file attributes or +// metadata was last changed, in ISO 8601 format. +func FileChanged(val string) attribute.KeyValue { + return FileChangedKey.String(val) +} + +// FileCreated returns an attribute KeyValue conforming to the "file.created" +// semantic conventions. It represents the time when the file was created, in ISO +// 8601 format. +func FileCreated(val string) attribute.KeyValue { + return FileCreatedKey.String(val) +} + +// FileDirectory returns an attribute KeyValue conforming to the "file.directory" +// semantic conventions. It represents the directory where the file is located. +// It should include the drive letter, when appropriate. +func FileDirectory(val string) attribute.KeyValue { + return FileDirectoryKey.String(val) +} + +// FileExtension returns an attribute KeyValue conforming to the "file.extension" +// semantic conventions. It represents the file extension, excluding the leading +// dot. +func FileExtension(val string) attribute.KeyValue { + return FileExtensionKey.String(val) +} + +// FileForkName returns an attribute KeyValue conforming to the "file.fork_name" +// semantic conventions. It represents the name of the fork. A fork is additional +// data associated with a filesystem object. +func FileForkName(val string) attribute.KeyValue { + return FileForkNameKey.String(val) +} + +// FileGroupID returns an attribute KeyValue conforming to the "file.group.id" +// semantic conventions. It represents the primary Group ID (GID) of the file. +func FileGroupID(val string) attribute.KeyValue { + return FileGroupIDKey.String(val) +} + +// FileGroupName returns an attribute KeyValue conforming to the +// "file.group.name" semantic conventions. It represents the primary group name +// of the file. +func FileGroupName(val string) attribute.KeyValue { + return FileGroupNameKey.String(val) +} + +// FileInode returns an attribute KeyValue conforming to the "file.inode" +// semantic conventions. It represents the inode representing the file in the +// filesystem. +func FileInode(val string) attribute.KeyValue { + return FileInodeKey.String(val) +} + +// FileMode returns an attribute KeyValue conforming to the "file.mode" semantic +// conventions. It represents the mode of the file in octal representation. +func FileMode(val string) attribute.KeyValue { + return FileModeKey.String(val) +} + +// FileModified returns an attribute KeyValue conforming to the "file.modified" +// semantic conventions. It represents the time when the file content was last +// modified, in ISO 8601 format. +func FileModified(val string) attribute.KeyValue { + return FileModifiedKey.String(val) +} + +// FileName returns an attribute KeyValue conforming to the "file.name" semantic +// conventions. It represents the name of the file including the extension, +// without the directory. +func FileName(val string) attribute.KeyValue { + return FileNameKey.String(val) +} + +// FileOwnerID returns an attribute KeyValue conforming to the "file.owner.id" +// semantic conventions. It represents the user ID (UID) or security identifier +// (SID) of the file owner. +func FileOwnerID(val string) attribute.KeyValue { + return FileOwnerIDKey.String(val) +} + +// FileOwnerName returns an attribute KeyValue conforming to the +// "file.owner.name" semantic conventions. It represents the username of the file +// owner. +func FileOwnerName(val string) attribute.KeyValue { + return FileOwnerNameKey.String(val) +} + +// FilePath returns an attribute KeyValue conforming to the "file.path" semantic +// conventions. It represents the full path to the file, including the file name. +// It should include the drive letter, when appropriate. +func FilePath(val string) attribute.KeyValue { + return FilePathKey.String(val) +} + +// FileSize returns an attribute KeyValue conforming to the "file.size" semantic +// conventions. It represents the file size in bytes. +func FileSize(val int) attribute.KeyValue { + return FileSizeKey.Int(val) +} + +// FileSymbolicLinkTargetPath returns an attribute KeyValue conforming to the +// "file.symbolic_link.target_path" semantic conventions. It represents the path +// to the target of a symbolic link. +func FileSymbolicLinkTargetPath(val string) attribute.KeyValue { + return FileSymbolicLinkTargetPathKey.String(val) +} + +// Namespace: gcp +const ( + // GCPAppHubApplicationContainerKey is the attribute Key conforming to the + // "gcp.apphub.application.container" semantic conventions. It represents the + // container within GCP where the AppHub application is defined. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "projects/my-container-project" + GCPAppHubApplicationContainerKey = attribute.Key("gcp.apphub.application.container") + + // GCPAppHubApplicationIDKey is the attribute Key conforming to the + // "gcp.apphub.application.id" semantic conventions. It represents the name of + // the application as configured in AppHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-application" + GCPAppHubApplicationIDKey = attribute.Key("gcp.apphub.application.id") + + // GCPAppHubApplicationLocationKey is the attribute Key conforming to the + // "gcp.apphub.application.location" semantic conventions. It represents the GCP + // zone or region where the application is defined. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-central1" + GCPAppHubApplicationLocationKey = attribute.Key("gcp.apphub.application.location") + + // GCPAppHubServiceCriticalityTypeKey is the attribute Key conforming to the + // "gcp.apphub.service.criticality_type" semantic conventions. It represents the + // criticality of a service indicates its importance to the business. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub type enum] + // + // [See AppHub type enum]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type + GCPAppHubServiceCriticalityTypeKey = attribute.Key("gcp.apphub.service.criticality_type") + + // GCPAppHubServiceEnvironmentTypeKey is the attribute Key conforming to the + // "gcp.apphub.service.environment_type" semantic conventions. It represents the + // environment of a service is the stage of a software lifecycle. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub environment type] + // + // [See AppHub environment type]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type_1 + GCPAppHubServiceEnvironmentTypeKey = attribute.Key("gcp.apphub.service.environment_type") + + // GCPAppHubServiceIDKey is the attribute Key conforming to the + // "gcp.apphub.service.id" semantic conventions. It represents the name of the + // service as configured in AppHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-service" + GCPAppHubServiceIDKey = attribute.Key("gcp.apphub.service.id") + + // GCPAppHubWorkloadCriticalityTypeKey is the attribute Key conforming to the + // "gcp.apphub.workload.criticality_type" semantic conventions. It represents + // the criticality of a workload indicates its importance to the business. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub type enum] + // + // [See AppHub type enum]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type + GCPAppHubWorkloadCriticalityTypeKey = attribute.Key("gcp.apphub.workload.criticality_type") + + // GCPAppHubWorkloadEnvironmentTypeKey is the attribute Key conforming to the + // "gcp.apphub.workload.environment_type" semantic conventions. It represents + // the environment of a workload is the stage of a software lifecycle. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub environment type] + // + // [See AppHub environment type]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type_1 + GCPAppHubWorkloadEnvironmentTypeKey = attribute.Key("gcp.apphub.workload.environment_type") + + // GCPAppHubWorkloadIDKey is the attribute Key conforming to the + // "gcp.apphub.workload.id" semantic conventions. It represents the name of the + // workload as configured in AppHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-workload" + GCPAppHubWorkloadIDKey = attribute.Key("gcp.apphub.workload.id") + + // GCPClientServiceKey is the attribute Key conforming to the + // "gcp.client.service" semantic conventions. It represents the identifies the + // Google Cloud service for which the official client library is intended. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "appengine", "run", "firestore", "alloydb", "spanner" + // Note: Intended to be a stable identifier for Google Cloud client libraries + // that is uniform across implementation languages. The value should be derived + // from the canonical service domain for the service; for example, + // 'foo.googleapis.com' should result in a value of 'foo'. + GCPClientServiceKey = attribute.Key("gcp.client.service") + + // GCPCloudRunJobExecutionKey is the attribute Key conforming to the + // "gcp.cloud_run.job.execution" semantic conventions. It represents the name of + // the Cloud Run [execution] being run for the Job, as set by the + // [`CLOUD_RUN_EXECUTION`] environment variable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "job-name-xxxx", "sample-job-mdw84" + // + // [execution]: https://cloud.google.com/run/docs/managing/job-executions + // [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars + GCPCloudRunJobExecutionKey = attribute.Key("gcp.cloud_run.job.execution") + + // GCPCloudRunJobTaskIndexKey is the attribute Key conforming to the + // "gcp.cloud_run.job.task_index" semantic conventions. It represents the index + // for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`] + // environment variable. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 1 + // + // [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars + GCPCloudRunJobTaskIndexKey = attribute.Key("gcp.cloud_run.job.task_index") + + // GCPGCEInstanceHostnameKey is the attribute Key conforming to the + // "gcp.gce.instance.hostname" semantic conventions. It represents the hostname + // of a GCE instance. This is the full value of the default or [custom hostname] + // . + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-host1234.example.com", + // "sample-vm.us-west1-b.c.my-project.internal" + // + // [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm + GCPGCEInstanceHostnameKey = attribute.Key("gcp.gce.instance.hostname") + + // GCPGCEInstanceNameKey is the attribute Key conforming to the + // "gcp.gce.instance.name" semantic conventions. It represents the instance name + // of a GCE instance. This is the value provided by `host.name`, the visible + // name of the instance in the Cloud Console UI, and the prefix for the default + // hostname of the instance as defined by the [default internal DNS name]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "instance-1", "my-vm-name" + // + // [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names + GCPGCEInstanceNameKey = attribute.Key("gcp.gce.instance.name") +) + +// GCPAppHubApplicationContainer returns an attribute KeyValue conforming to the +// "gcp.apphub.application.container" semantic conventions. It represents the +// container within GCP where the AppHub application is defined. +func GCPAppHubApplicationContainer(val string) attribute.KeyValue { + return GCPAppHubApplicationContainerKey.String(val) +} + +// GCPAppHubApplicationID returns an attribute KeyValue conforming to the +// "gcp.apphub.application.id" semantic conventions. It represents the name of +// the application as configured in AppHub. +func GCPAppHubApplicationID(val string) attribute.KeyValue { + return GCPAppHubApplicationIDKey.String(val) +} + +// GCPAppHubApplicationLocation returns an attribute KeyValue conforming to the +// "gcp.apphub.application.location" semantic conventions. It represents the GCP +// zone or region where the application is defined. +func GCPAppHubApplicationLocation(val string) attribute.KeyValue { + return GCPAppHubApplicationLocationKey.String(val) +} + +// GCPAppHubServiceID returns an attribute KeyValue conforming to the +// "gcp.apphub.service.id" semantic conventions. It represents the name of the +// service as configured in AppHub. +func GCPAppHubServiceID(val string) attribute.KeyValue { + return GCPAppHubServiceIDKey.String(val) +} + +// GCPAppHubWorkloadID returns an attribute KeyValue conforming to the +// "gcp.apphub.workload.id" semantic conventions. It represents the name of the +// workload as configured in AppHub. +func GCPAppHubWorkloadID(val string) attribute.KeyValue { + return GCPAppHubWorkloadIDKey.String(val) +} + +// GCPClientService returns an attribute KeyValue conforming to the +// "gcp.client.service" semantic conventions. It represents the identifies the +// Google Cloud service for which the official client library is intended. +func GCPClientService(val string) attribute.KeyValue { + return GCPClientServiceKey.String(val) +} + +// GCPCloudRunJobExecution returns an attribute KeyValue conforming to the +// "gcp.cloud_run.job.execution" semantic conventions. It represents the name of +// the Cloud Run [execution] being run for the Job, as set by the +// [`CLOUD_RUN_EXECUTION`] environment variable. +// +// [execution]: https://cloud.google.com/run/docs/managing/job-executions +// [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars +func GCPCloudRunJobExecution(val string) attribute.KeyValue { + return GCPCloudRunJobExecutionKey.String(val) +} + +// GCPCloudRunJobTaskIndex returns an attribute KeyValue conforming to the +// "gcp.cloud_run.job.task_index" semantic conventions. It represents the index +// for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`] +// environment variable. +// +// [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars +func GCPCloudRunJobTaskIndex(val int) attribute.KeyValue { + return GCPCloudRunJobTaskIndexKey.Int(val) +} + +// GCPGCEInstanceHostname returns an attribute KeyValue conforming to the +// "gcp.gce.instance.hostname" semantic conventions. It represents the hostname +// of a GCE instance. This is the full value of the default or [custom hostname] +// . +// +// [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm +func GCPGCEInstanceHostname(val string) attribute.KeyValue { + return GCPGCEInstanceHostnameKey.String(val) +} + +// GCPGCEInstanceName returns an attribute KeyValue conforming to the +// "gcp.gce.instance.name" semantic conventions. It represents the instance name +// of a GCE instance. This is the value provided by `host.name`, the visible name +// of the instance in the Cloud Console UI, and the prefix for the default +// hostname of the instance as defined by the [default internal DNS name]. +// +// [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names +func GCPGCEInstanceName(val string) attribute.KeyValue { + return GCPGCEInstanceNameKey.String(val) +} + +// Enum values for gcp.apphub.service.criticality_type +var ( + // Mission critical service. + // Stability: development + GCPAppHubServiceCriticalityTypeMissionCritical = GCPAppHubServiceCriticalityTypeKey.String("MISSION_CRITICAL") + // High impact. + // Stability: development + GCPAppHubServiceCriticalityTypeHigh = GCPAppHubServiceCriticalityTypeKey.String("HIGH") + // Medium impact. + // Stability: development + GCPAppHubServiceCriticalityTypeMedium = GCPAppHubServiceCriticalityTypeKey.String("MEDIUM") + // Low impact. + // Stability: development + GCPAppHubServiceCriticalityTypeLow = GCPAppHubServiceCriticalityTypeKey.String("LOW") +) + +// Enum values for gcp.apphub.service.environment_type +var ( + // Production environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeProduction = GCPAppHubServiceEnvironmentTypeKey.String("PRODUCTION") + // Staging environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeStaging = GCPAppHubServiceEnvironmentTypeKey.String("STAGING") + // Test environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeTest = GCPAppHubServiceEnvironmentTypeKey.String("TEST") + // Development environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeDevelopment = GCPAppHubServiceEnvironmentTypeKey.String("DEVELOPMENT") +) + +// Enum values for gcp.apphub.workload.criticality_type +var ( + // Mission critical service. + // Stability: development + GCPAppHubWorkloadCriticalityTypeMissionCritical = GCPAppHubWorkloadCriticalityTypeKey.String("MISSION_CRITICAL") + // High impact. + // Stability: development + GCPAppHubWorkloadCriticalityTypeHigh = GCPAppHubWorkloadCriticalityTypeKey.String("HIGH") + // Medium impact. + // Stability: development + GCPAppHubWorkloadCriticalityTypeMedium = GCPAppHubWorkloadCriticalityTypeKey.String("MEDIUM") + // Low impact. + // Stability: development + GCPAppHubWorkloadCriticalityTypeLow = GCPAppHubWorkloadCriticalityTypeKey.String("LOW") +) + +// Enum values for gcp.apphub.workload.environment_type +var ( + // Production environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeProduction = GCPAppHubWorkloadEnvironmentTypeKey.String("PRODUCTION") + // Staging environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeStaging = GCPAppHubWorkloadEnvironmentTypeKey.String("STAGING") + // Test environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeTest = GCPAppHubWorkloadEnvironmentTypeKey.String("TEST") + // Development environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeDevelopment = GCPAppHubWorkloadEnvironmentTypeKey.String("DEVELOPMENT") +) + +// Namespace: gen_ai +const ( + // GenAIAgentDescriptionKey is the attribute Key conforming to the + // "gen_ai.agent.description" semantic conventions. It represents the free-form + // description of the GenAI agent provided by the application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Helps with math problems", "Generates fiction stories" + GenAIAgentDescriptionKey = attribute.Key("gen_ai.agent.description") + + // GenAIAgentIDKey is the attribute Key conforming to the "gen_ai.agent.id" + // semantic conventions. It represents the unique identifier of the GenAI agent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "asst_5j66UpCpwteGg4YSxUnt7lPY" + GenAIAgentIDKey = attribute.Key("gen_ai.agent.id") + + // GenAIAgentNameKey is the attribute Key conforming to the "gen_ai.agent.name" + // semantic conventions. It represents the human-readable name of the GenAI + // agent provided by the application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Math Tutor", "Fiction Writer" + GenAIAgentNameKey = attribute.Key("gen_ai.agent.name") + + // GenAIConversationIDKey is the attribute Key conforming to the + // "gen_ai.conversation.id" semantic conventions. It represents the unique + // identifier for a conversation (session, thread), used to store and correlate + // messages within this conversation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "conv_5j66UpCpwteGg4YSxUnt7lPY" + GenAIConversationIDKey = attribute.Key("gen_ai.conversation.id") + + // GenAIDataSourceIDKey is the attribute Key conforming to the + // "gen_ai.data_source.id" semantic conventions. It represents the data source + // identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "H7STPQYOND" + // Note: Data sources are used by AI agents and RAG applications to store + // grounding data. A data source may be an external database, object store, + // document collection, website, or any other storage system used by the GenAI + // agent or application. The `gen_ai.data_source.id` SHOULD match the identifier + // used by the GenAI system rather than a name specific to the external storage, + // such as a database or object store. Semantic conventions referencing + // `gen_ai.data_source.id` MAY also leverage additional attributes, such as + // `db.*`, to further identify and describe the data source. + GenAIDataSourceIDKey = attribute.Key("gen_ai.data_source.id") + + // GenAIOpenAIRequestServiceTierKey is the attribute Key conforming to the + // "gen_ai.openai.request.service_tier" semantic conventions. It represents the + // service tier requested. May be a specific tier, default, or auto. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "auto", "default" + GenAIOpenAIRequestServiceTierKey = attribute.Key("gen_ai.openai.request.service_tier") + + // GenAIOpenAIResponseServiceTierKey is the attribute Key conforming to the + // "gen_ai.openai.response.service_tier" semantic conventions. It represents the + // service tier used for the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "scale", "default" + GenAIOpenAIResponseServiceTierKey = attribute.Key("gen_ai.openai.response.service_tier") + + // GenAIOpenAIResponseSystemFingerprintKey is the attribute Key conforming to + // the "gen_ai.openai.response.system_fingerprint" semantic conventions. It + // represents a fingerprint to track any eventual change in the Generative AI + // environment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "fp_44709d6fcb" + GenAIOpenAIResponseSystemFingerprintKey = attribute.Key("gen_ai.openai.response.system_fingerprint") + + // GenAIOperationNameKey is the attribute Key conforming to the + // "gen_ai.operation.name" semantic conventions. It represents the name of the + // operation being performed. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: If one of the predefined values applies, but specific system uses a + // different name it's RECOMMENDED to document it in the semantic conventions + // for specific GenAI system and use system-specific name in the + // instrumentation. If a different name is not documented, instrumentation + // libraries SHOULD use applicable predefined value. + GenAIOperationNameKey = attribute.Key("gen_ai.operation.name") + + // GenAIOutputTypeKey is the attribute Key conforming to the + // "gen_ai.output.type" semantic conventions. It represents the represents the + // content type requested by the client. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This attribute SHOULD be used when the client requests output of a + // specific type. The model may return zero or more outputs of this type. + // This attribute specifies the output modality and not the actual output + // format. For example, if an image is requested, the actual output could be a + // URL pointing to an image file. + // Additional output format details may be recorded in the future in the + // `gen_ai.output.{type}.*` attributes. + GenAIOutputTypeKey = attribute.Key("gen_ai.output.type") + + // GenAIRequestChoiceCountKey is the attribute Key conforming to the + // "gen_ai.request.choice.count" semantic conventions. It represents the target + // number of candidate completions to return. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3 + GenAIRequestChoiceCountKey = attribute.Key("gen_ai.request.choice.count") + + // GenAIRequestEncodingFormatsKey is the attribute Key conforming to the + // "gen_ai.request.encoding_formats" semantic conventions. It represents the + // encoding formats requested in an embeddings operation, if specified. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "base64"], ["float", "binary" + // Note: In some GenAI systems the encoding formats are called embedding types. + // Also, some GenAI systems only accept a single format per request. + GenAIRequestEncodingFormatsKey = attribute.Key("gen_ai.request.encoding_formats") + + // GenAIRequestFrequencyPenaltyKey is the attribute Key conforming to the + // "gen_ai.request.frequency_penalty" semantic conventions. It represents the + // frequency penalty setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.1 + GenAIRequestFrequencyPenaltyKey = attribute.Key("gen_ai.request.frequency_penalty") + + // GenAIRequestMaxTokensKey is the attribute Key conforming to the + // "gen_ai.request.max_tokens" semantic conventions. It represents the maximum + // number of tokens the model generates for a request. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIRequestMaxTokensKey = attribute.Key("gen_ai.request.max_tokens") + + // GenAIRequestModelKey is the attribute Key conforming to the + // "gen_ai.request.model" semantic conventions. It represents the name of the + // GenAI model a request is being made to. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: gpt-4 + GenAIRequestModelKey = attribute.Key("gen_ai.request.model") + + // GenAIRequestPresencePenaltyKey is the attribute Key conforming to the + // "gen_ai.request.presence_penalty" semantic conventions. It represents the + // presence penalty setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.1 + GenAIRequestPresencePenaltyKey = attribute.Key("gen_ai.request.presence_penalty") + + // GenAIRequestSeedKey is the attribute Key conforming to the + // "gen_ai.request.seed" semantic conventions. It represents the requests with + // same seed value more likely to return same result. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIRequestSeedKey = attribute.Key("gen_ai.request.seed") + + // GenAIRequestStopSequencesKey is the attribute Key conforming to the + // "gen_ai.request.stop_sequences" semantic conventions. It represents the list + // of sequences that the model will use to stop generating further tokens. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "forest", "lived" + GenAIRequestStopSequencesKey = attribute.Key("gen_ai.request.stop_sequences") + + // GenAIRequestTemperatureKey is the attribute Key conforming to the + // "gen_ai.request.temperature" semantic conventions. It represents the + // temperature setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.0 + GenAIRequestTemperatureKey = attribute.Key("gen_ai.request.temperature") + + // GenAIRequestTopKKey is the attribute Key conforming to the + // "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling + // setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + GenAIRequestTopKKey = attribute.Key("gen_ai.request.top_k") + + // GenAIRequestTopPKey is the attribute Key conforming to the + // "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling + // setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + GenAIRequestTopPKey = attribute.Key("gen_ai.request.top_p") + + // GenAIResponseFinishReasonsKey is the attribute Key conforming to the + // "gen_ai.response.finish_reasons" semantic conventions. It represents the + // array of reasons the model stopped generating tokens, corresponding to each + // generation received. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "stop"], ["stop", "length" + GenAIResponseFinishReasonsKey = attribute.Key("gen_ai.response.finish_reasons") + + // GenAIResponseIDKey is the attribute Key conforming to the + // "gen_ai.response.id" semantic conventions. It represents the unique + // identifier for the completion. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "chatcmpl-123" + GenAIResponseIDKey = attribute.Key("gen_ai.response.id") + + // GenAIResponseModelKey is the attribute Key conforming to the + // "gen_ai.response.model" semantic conventions. It represents the name of the + // model that generated the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "gpt-4-0613" + GenAIResponseModelKey = attribute.Key("gen_ai.response.model") + + // GenAISystemKey is the attribute Key conforming to the "gen_ai.system" + // semantic conventions. It represents the Generative AI product as identified + // by the client or server instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: openai + // Note: The `gen_ai.system` describes a family of GenAI models with specific + // model identified + // by `gen_ai.request.model` and `gen_ai.response.model` attributes. + // + // The actual GenAI product may differ from the one identified by the client. + // Multiple systems, including Azure OpenAI and Gemini, are accessible by OpenAI + // client + // libraries. In such cases, the `gen_ai.system` is set to `openai` based on the + // instrumentation's best knowledge, instead of the actual system. The + // `server.address` + // attribute may help identify the actual system in use for `openai`. + // + // For custom model, a custom friendly name SHOULD be used. + // If none of these options apply, the `gen_ai.system` SHOULD be set to `_OTHER` + // . + GenAISystemKey = attribute.Key("gen_ai.system") + + // GenAITokenTypeKey is the attribute Key conforming to the "gen_ai.token.type" + // semantic conventions. It represents the type of token being counted. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "input", "output" + GenAITokenTypeKey = attribute.Key("gen_ai.token.type") + + // GenAIToolCallIDKey is the attribute Key conforming to the + // "gen_ai.tool.call.id" semantic conventions. It represents the tool call + // identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "call_mszuSIzqtI65i1wAUOE8w5H4" + GenAIToolCallIDKey = attribute.Key("gen_ai.tool.call.id") + + // GenAIToolDescriptionKey is the attribute Key conforming to the + // "gen_ai.tool.description" semantic conventions. It represents the tool + // description. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Multiply two numbers" + GenAIToolDescriptionKey = attribute.Key("gen_ai.tool.description") + + // GenAIToolNameKey is the attribute Key conforming to the "gen_ai.tool.name" + // semantic conventions. It represents the name of the tool utilized by the + // agent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Flights" + GenAIToolNameKey = attribute.Key("gen_ai.tool.name") + + // GenAIToolTypeKey is the attribute Key conforming to the "gen_ai.tool.type" + // semantic conventions. It represents the type of the tool utilized by the + // agent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "function", "extension", "datastore" + // Note: Extension: A tool executed on the agent-side to directly call external + // APIs, bridging the gap between the agent and real-world systems. + // Agent-side operations involve actions that are performed by the agent on the + // server or within the agent's controlled environment. + // Function: A tool executed on the client-side, where the agent generates + // parameters for a predefined function, and the client executes the logic. + // Client-side operations are actions taken on the user's end or within the + // client application. + // Datastore: A tool used by the agent to access and query structured or + // unstructured external data for retrieval-augmented tasks or knowledge + // updates. + GenAIToolTypeKey = attribute.Key("gen_ai.tool.type") + + // GenAIUsageInputTokensKey is the attribute Key conforming to the + // "gen_ai.usage.input_tokens" semantic conventions. It represents the number of + // tokens used in the GenAI input (prompt). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIUsageInputTokensKey = attribute.Key("gen_ai.usage.input_tokens") + + // GenAIUsageOutputTokensKey is the attribute Key conforming to the + // "gen_ai.usage.output_tokens" semantic conventions. It represents the number + // of tokens used in the GenAI response (completion). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 180 + GenAIUsageOutputTokensKey = attribute.Key("gen_ai.usage.output_tokens") +) + +// GenAIAgentDescription returns an attribute KeyValue conforming to the +// "gen_ai.agent.description" semantic conventions. It represents the free-form +// description of the GenAI agent provided by the application. +func GenAIAgentDescription(val string) attribute.KeyValue { + return GenAIAgentDescriptionKey.String(val) +} + +// GenAIAgentID returns an attribute KeyValue conforming to the "gen_ai.agent.id" +// semantic conventions. It represents the unique identifier of the GenAI agent. +func GenAIAgentID(val string) attribute.KeyValue { + return GenAIAgentIDKey.String(val) +} + +// GenAIAgentName returns an attribute KeyValue conforming to the +// "gen_ai.agent.name" semantic conventions. It represents the human-readable +// name of the GenAI agent provided by the application. +func GenAIAgentName(val string) attribute.KeyValue { + return GenAIAgentNameKey.String(val) +} + +// GenAIConversationID returns an attribute KeyValue conforming to the +// "gen_ai.conversation.id" semantic conventions. It represents the unique +// identifier for a conversation (session, thread), used to store and correlate +// messages within this conversation. +func GenAIConversationID(val string) attribute.KeyValue { + return GenAIConversationIDKey.String(val) +} + +// GenAIDataSourceID returns an attribute KeyValue conforming to the +// "gen_ai.data_source.id" semantic conventions. It represents the data source +// identifier. +func GenAIDataSourceID(val string) attribute.KeyValue { + return GenAIDataSourceIDKey.String(val) +} + +// GenAIOpenAIResponseServiceTier returns an attribute KeyValue conforming to the +// "gen_ai.openai.response.service_tier" semantic conventions. It represents the +// service tier used for the response. +func GenAIOpenAIResponseServiceTier(val string) attribute.KeyValue { + return GenAIOpenAIResponseServiceTierKey.String(val) +} + +// GenAIOpenAIResponseSystemFingerprint returns an attribute KeyValue conforming +// to the "gen_ai.openai.response.system_fingerprint" semantic conventions. It +// represents a fingerprint to track any eventual change in the Generative AI +// environment. +func GenAIOpenAIResponseSystemFingerprint(val string) attribute.KeyValue { + return GenAIOpenAIResponseSystemFingerprintKey.String(val) +} + +// GenAIRequestChoiceCount returns an attribute KeyValue conforming to the +// "gen_ai.request.choice.count" semantic conventions. It represents the target +// number of candidate completions to return. +func GenAIRequestChoiceCount(val int) attribute.KeyValue { + return GenAIRequestChoiceCountKey.Int(val) +} + +// GenAIRequestEncodingFormats returns an attribute KeyValue conforming to the +// "gen_ai.request.encoding_formats" semantic conventions. It represents the +// encoding formats requested in an embeddings operation, if specified. +func GenAIRequestEncodingFormats(val ...string) attribute.KeyValue { + return GenAIRequestEncodingFormatsKey.StringSlice(val) +} + +// GenAIRequestFrequencyPenalty returns an attribute KeyValue conforming to the +// "gen_ai.request.frequency_penalty" semantic conventions. It represents the +// frequency penalty setting for the GenAI request. +func GenAIRequestFrequencyPenalty(val float64) attribute.KeyValue { + return GenAIRequestFrequencyPenaltyKey.Float64(val) +} + +// GenAIRequestMaxTokens returns an attribute KeyValue conforming to the +// "gen_ai.request.max_tokens" semantic conventions. It represents the maximum +// number of tokens the model generates for a request. +func GenAIRequestMaxTokens(val int) attribute.KeyValue { + return GenAIRequestMaxTokensKey.Int(val) +} + +// GenAIRequestModel returns an attribute KeyValue conforming to the +// "gen_ai.request.model" semantic conventions. It represents the name of the +// GenAI model a request is being made to. +func GenAIRequestModel(val string) attribute.KeyValue { + return GenAIRequestModelKey.String(val) +} + +// GenAIRequestPresencePenalty returns an attribute KeyValue conforming to the +// "gen_ai.request.presence_penalty" semantic conventions. It represents the +// presence penalty setting for the GenAI request. +func GenAIRequestPresencePenalty(val float64) attribute.KeyValue { + return GenAIRequestPresencePenaltyKey.Float64(val) +} + +// GenAIRequestSeed returns an attribute KeyValue conforming to the +// "gen_ai.request.seed" semantic conventions. It represents the requests with +// same seed value more likely to return same result. +func GenAIRequestSeed(val int) attribute.KeyValue { + return GenAIRequestSeedKey.Int(val) +} + +// GenAIRequestStopSequences returns an attribute KeyValue conforming to the +// "gen_ai.request.stop_sequences" semantic conventions. It represents the list +// of sequences that the model will use to stop generating further tokens. +func GenAIRequestStopSequences(val ...string) attribute.KeyValue { + return GenAIRequestStopSequencesKey.StringSlice(val) +} + +// GenAIRequestTemperature returns an attribute KeyValue conforming to the +// "gen_ai.request.temperature" semantic conventions. It represents the +// temperature setting for the GenAI request. +func GenAIRequestTemperature(val float64) attribute.KeyValue { + return GenAIRequestTemperatureKey.Float64(val) +} + +// GenAIRequestTopK returns an attribute KeyValue conforming to the +// "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling +// setting for the GenAI request. +func GenAIRequestTopK(val float64) attribute.KeyValue { + return GenAIRequestTopKKey.Float64(val) +} + +// GenAIRequestTopP returns an attribute KeyValue conforming to the +// "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling +// setting for the GenAI request. +func GenAIRequestTopP(val float64) attribute.KeyValue { + return GenAIRequestTopPKey.Float64(val) +} + +// GenAIResponseFinishReasons returns an attribute KeyValue conforming to the +// "gen_ai.response.finish_reasons" semantic conventions. It represents the array +// of reasons the model stopped generating tokens, corresponding to each +// generation received. +func GenAIResponseFinishReasons(val ...string) attribute.KeyValue { + return GenAIResponseFinishReasonsKey.StringSlice(val) +} + +// GenAIResponseID returns an attribute KeyValue conforming to the +// "gen_ai.response.id" semantic conventions. It represents the unique identifier +// for the completion. +func GenAIResponseID(val string) attribute.KeyValue { + return GenAIResponseIDKey.String(val) +} + +// GenAIResponseModel returns an attribute KeyValue conforming to the +// "gen_ai.response.model" semantic conventions. It represents the name of the +// model that generated the response. +func GenAIResponseModel(val string) attribute.KeyValue { + return GenAIResponseModelKey.String(val) +} + +// GenAIToolCallID returns an attribute KeyValue conforming to the +// "gen_ai.tool.call.id" semantic conventions. It represents the tool call +// identifier. +func GenAIToolCallID(val string) attribute.KeyValue { + return GenAIToolCallIDKey.String(val) +} + +// GenAIToolDescription returns an attribute KeyValue conforming to the +// "gen_ai.tool.description" semantic conventions. It represents the tool +// description. +func GenAIToolDescription(val string) attribute.KeyValue { + return GenAIToolDescriptionKey.String(val) +} + +// GenAIToolName returns an attribute KeyValue conforming to the +// "gen_ai.tool.name" semantic conventions. It represents the name of the tool +// utilized by the agent. +func GenAIToolName(val string) attribute.KeyValue { + return GenAIToolNameKey.String(val) +} + +// GenAIToolType returns an attribute KeyValue conforming to the +// "gen_ai.tool.type" semantic conventions. It represents the type of the tool +// utilized by the agent. +func GenAIToolType(val string) attribute.KeyValue { + return GenAIToolTypeKey.String(val) +} + +// GenAIUsageInputTokens returns an attribute KeyValue conforming to the +// "gen_ai.usage.input_tokens" semantic conventions. It represents the number of +// tokens used in the GenAI input (prompt). +func GenAIUsageInputTokens(val int) attribute.KeyValue { + return GenAIUsageInputTokensKey.Int(val) +} + +// GenAIUsageOutputTokens returns an attribute KeyValue conforming to the +// "gen_ai.usage.output_tokens" semantic conventions. It represents the number of +// tokens used in the GenAI response (completion). +func GenAIUsageOutputTokens(val int) attribute.KeyValue { + return GenAIUsageOutputTokensKey.Int(val) +} + +// Enum values for gen_ai.openai.request.service_tier +var ( + // The system will utilize scale tier credits until they are exhausted. + // Stability: development + GenAIOpenAIRequestServiceTierAuto = GenAIOpenAIRequestServiceTierKey.String("auto") + // The system will utilize the default scale tier. + // Stability: development + GenAIOpenAIRequestServiceTierDefault = GenAIOpenAIRequestServiceTierKey.String("default") +) + +// Enum values for gen_ai.operation.name +var ( + // Chat completion operation such as [OpenAI Chat API] + // Stability: development + // + // [OpenAI Chat API]: https://platform.openai.com/docs/api-reference/chat + GenAIOperationNameChat = GenAIOperationNameKey.String("chat") + // Multimodal content generation operation such as [Gemini Generate Content] + // Stability: development + // + // [Gemini Generate Content]: https://ai.google.dev/api/generate-content + GenAIOperationNameGenerateContent = GenAIOperationNameKey.String("generate_content") + // Text completions operation such as [OpenAI Completions API (Legacy)] + // Stability: development + // + // [OpenAI Completions API (Legacy)]: https://platform.openai.com/docs/api-reference/completions + GenAIOperationNameTextCompletion = GenAIOperationNameKey.String("text_completion") + // Embeddings operation such as [OpenAI Create embeddings API] + // Stability: development + // + // [OpenAI Create embeddings API]: https://platform.openai.com/docs/api-reference/embeddings/create + GenAIOperationNameEmbeddings = GenAIOperationNameKey.String("embeddings") + // Create GenAI agent + // Stability: development + GenAIOperationNameCreateAgent = GenAIOperationNameKey.String("create_agent") + // Invoke GenAI agent + // Stability: development + GenAIOperationNameInvokeAgent = GenAIOperationNameKey.String("invoke_agent") + // Execute a tool + // Stability: development + GenAIOperationNameExecuteTool = GenAIOperationNameKey.String("execute_tool") +) + +// Enum values for gen_ai.output.type +var ( + // Plain text + // Stability: development + GenAIOutputTypeText = GenAIOutputTypeKey.String("text") + // JSON object with known or unknown schema + // Stability: development + GenAIOutputTypeJSON = GenAIOutputTypeKey.String("json") + // Image + // Stability: development + GenAIOutputTypeImage = GenAIOutputTypeKey.String("image") + // Speech + // Stability: development + GenAIOutputTypeSpeech = GenAIOutputTypeKey.String("speech") +) + +// Enum values for gen_ai.system +var ( + // OpenAI + // Stability: development + GenAISystemOpenAI = GenAISystemKey.String("openai") + // Any Google generative AI endpoint + // Stability: development + GenAISystemGCPGenAI = GenAISystemKey.String("gcp.gen_ai") + // Vertex AI + // Stability: development + GenAISystemGCPVertexAI = GenAISystemKey.String("gcp.vertex_ai") + // Gemini + // Stability: development + GenAISystemGCPGemini = GenAISystemKey.String("gcp.gemini") + // Deprecated: Use 'gcp.vertex_ai' instead. + GenAISystemVertexAI = GenAISystemKey.String("vertex_ai") + // Deprecated: Use 'gcp.gemini' instead. + GenAISystemGemini = GenAISystemKey.String("gemini") + // Anthropic + // Stability: development + GenAISystemAnthropic = GenAISystemKey.String("anthropic") + // Cohere + // Stability: development + GenAISystemCohere = GenAISystemKey.String("cohere") + // Azure AI Inference + // Stability: development + GenAISystemAzAIInference = GenAISystemKey.String("az.ai.inference") + // Azure OpenAI + // Stability: development + GenAISystemAzAIOpenAI = GenAISystemKey.String("az.ai.openai") + // IBM Watsonx AI + // Stability: development + GenAISystemIBMWatsonxAI = GenAISystemKey.String("ibm.watsonx.ai") + // AWS Bedrock + // Stability: development + GenAISystemAWSBedrock = GenAISystemKey.String("aws.bedrock") + // Perplexity + // Stability: development + GenAISystemPerplexity = GenAISystemKey.String("perplexity") + // xAI + // Stability: development + GenAISystemXai = GenAISystemKey.String("xai") + // DeepSeek + // Stability: development + GenAISystemDeepseek = GenAISystemKey.String("deepseek") + // Groq + // Stability: development + GenAISystemGroq = GenAISystemKey.String("groq") + // Mistral AI + // Stability: development + GenAISystemMistralAI = GenAISystemKey.String("mistral_ai") +) + +// Enum values for gen_ai.token.type +var ( + // Input tokens (prompt, input, etc.) + // Stability: development + GenAITokenTypeInput = GenAITokenTypeKey.String("input") + // Deprecated: Replaced by `output`. + GenAITokenTypeCompletion = GenAITokenTypeKey.String("output") + // Output tokens (completion, response, etc.) + // Stability: development + GenAITokenTypeOutput = GenAITokenTypeKey.String("output") +) + +// Namespace: geo +const ( + // GeoContinentCodeKey is the attribute Key conforming to the + // "geo.continent.code" semantic conventions. It represents the two-letter code + // representing continent’s name. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + GeoContinentCodeKey = attribute.Key("geo.continent.code") + + // GeoCountryISOCodeKey is the attribute Key conforming to the + // "geo.country.iso_code" semantic conventions. It represents the two-letter ISO + // Country Code ([ISO 3166-1 alpha2]). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CA" + // + // [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes + GeoCountryISOCodeKey = attribute.Key("geo.country.iso_code") + + // GeoLocalityNameKey is the attribute Key conforming to the "geo.locality.name" + // semantic conventions. It represents the locality name. Represents the name of + // a city, town, village, or similar populated place. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Montreal", "Berlin" + GeoLocalityNameKey = attribute.Key("geo.locality.name") + + // GeoLocationLatKey is the attribute Key conforming to the "geo.location.lat" + // semantic conventions. It represents the latitude of the geo location in + // [WGS84]. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 45.505918 + // + // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 + GeoLocationLatKey = attribute.Key("geo.location.lat") + + // GeoLocationLonKey is the attribute Key conforming to the "geo.location.lon" + // semantic conventions. It represents the longitude of the geo location in + // [WGS84]. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: -73.61483 + // + // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 + GeoLocationLonKey = attribute.Key("geo.location.lon") + + // GeoPostalCodeKey is the attribute Key conforming to the "geo.postal_code" + // semantic conventions. It represents the postal code associated with the + // location. Values appropriate for this field may also be known as a postcode + // or ZIP code and will vary widely from country to country. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "94040" + GeoPostalCodeKey = attribute.Key("geo.postal_code") + + // GeoRegionISOCodeKey is the attribute Key conforming to the + // "geo.region.iso_code" semantic conventions. It represents the region ISO code + // ([ISO 3166-2]). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CA-QC" + // + // [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2 + GeoRegionISOCodeKey = attribute.Key("geo.region.iso_code") +) + +// GeoCountryISOCode returns an attribute KeyValue conforming to the +// "geo.country.iso_code" semantic conventions. It represents the two-letter ISO +// Country Code ([ISO 3166-1 alpha2]). +// +// [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes +func GeoCountryISOCode(val string) attribute.KeyValue { + return GeoCountryISOCodeKey.String(val) +} + +// GeoLocalityName returns an attribute KeyValue conforming to the +// "geo.locality.name" semantic conventions. It represents the locality name. +// Represents the name of a city, town, village, or similar populated place. +func GeoLocalityName(val string) attribute.KeyValue { + return GeoLocalityNameKey.String(val) +} + +// GeoLocationLat returns an attribute KeyValue conforming to the +// "geo.location.lat" semantic conventions. It represents the latitude of the geo +// location in [WGS84]. +// +// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 +func GeoLocationLat(val float64) attribute.KeyValue { + return GeoLocationLatKey.Float64(val) +} + +// GeoLocationLon returns an attribute KeyValue conforming to the +// "geo.location.lon" semantic conventions. It represents the longitude of the +// geo location in [WGS84]. +// +// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 +func GeoLocationLon(val float64) attribute.KeyValue { + return GeoLocationLonKey.Float64(val) +} + +// GeoPostalCode returns an attribute KeyValue conforming to the +// "geo.postal_code" semantic conventions. It represents the postal code +// associated with the location. Values appropriate for this field may also be +// known as a postcode or ZIP code and will vary widely from country to country. +func GeoPostalCode(val string) attribute.KeyValue { + return GeoPostalCodeKey.String(val) +} + +// GeoRegionISOCode returns an attribute KeyValue conforming to the +// "geo.region.iso_code" semantic conventions. It represents the region ISO code +// ([ISO 3166-2]). +// +// [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2 +func GeoRegionISOCode(val string) attribute.KeyValue { + return GeoRegionISOCodeKey.String(val) +} + +// Enum values for geo.continent.code +var ( + // Africa + // Stability: development + GeoContinentCodeAf = GeoContinentCodeKey.String("AF") + // Antarctica + // Stability: development + GeoContinentCodeAn = GeoContinentCodeKey.String("AN") + // Asia + // Stability: development + GeoContinentCodeAs = GeoContinentCodeKey.String("AS") + // Europe + // Stability: development + GeoContinentCodeEu = GeoContinentCodeKey.String("EU") + // North America + // Stability: development + GeoContinentCodeNa = GeoContinentCodeKey.String("NA") + // Oceania + // Stability: development + GeoContinentCodeOc = GeoContinentCodeKey.String("OC") + // South America + // Stability: development + GeoContinentCodeSa = GeoContinentCodeKey.String("SA") +) + +// Namespace: go +const ( + // GoMemoryTypeKey is the attribute Key conforming to the "go.memory.type" + // semantic conventions. It represents the type of memory. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "other", "stack" + GoMemoryTypeKey = attribute.Key("go.memory.type") +) + +// Enum values for go.memory.type +var ( + // Memory allocated from the heap that is reserved for stack space, whether or + // not it is currently in-use. + // Stability: development + GoMemoryTypeStack = GoMemoryTypeKey.String("stack") + // Memory used by the Go runtime, excluding other categories of memory usage + // described in this enumeration. + // Stability: development + GoMemoryTypeOther = GoMemoryTypeKey.String("other") +) + +// Namespace: graphql +const ( + // GraphQLDocumentKey is the attribute Key conforming to the "graphql.document" + // semantic conventions. It represents the GraphQL document being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: query findBookById { bookById(id: ?) { name } } + // Note: The value may be sanitized to exclude sensitive information. + GraphQLDocumentKey = attribute.Key("graphql.document") + + // GraphQLOperationNameKey is the attribute Key conforming to the + // "graphql.operation.name" semantic conventions. It represents the name of the + // operation being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: findBookById + GraphQLOperationNameKey = attribute.Key("graphql.operation.name") + + // GraphQLOperationTypeKey is the attribute Key conforming to the + // "graphql.operation.type" semantic conventions. It represents the type of the + // operation being executed. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "query", "mutation", "subscription" + GraphQLOperationTypeKey = attribute.Key("graphql.operation.type") +) + +// GraphQLDocument returns an attribute KeyValue conforming to the +// "graphql.document" semantic conventions. It represents the GraphQL document +// being executed. +func GraphQLDocument(val string) attribute.KeyValue { + return GraphQLDocumentKey.String(val) +} + +// GraphQLOperationName returns an attribute KeyValue conforming to the +// "graphql.operation.name" semantic conventions. It represents the name of the +// operation being executed. +func GraphQLOperationName(val string) attribute.KeyValue { + return GraphQLOperationNameKey.String(val) +} + +// Enum values for graphql.operation.type +var ( + // GraphQL query + // Stability: development + GraphQLOperationTypeQuery = GraphQLOperationTypeKey.String("query") + // GraphQL mutation + // Stability: development + GraphQLOperationTypeMutation = GraphQLOperationTypeKey.String("mutation") + // GraphQL subscription + // Stability: development + GraphQLOperationTypeSubscription = GraphQLOperationTypeKey.String("subscription") +) + +// Namespace: heroku +const ( + // HerokuAppIDKey is the attribute Key conforming to the "heroku.app.id" + // semantic conventions. It represents the unique identifier for the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2daa2797-e42b-4624-9322-ec3f968df4da" + HerokuAppIDKey = attribute.Key("heroku.app.id") + + // HerokuReleaseCommitKey is the attribute Key conforming to the + // "heroku.release.commit" semantic conventions. It represents the commit hash + // for the current release. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "e6134959463efd8966b20e75b913cafe3f5ec" + HerokuReleaseCommitKey = attribute.Key("heroku.release.commit") + + // HerokuReleaseCreationTimestampKey is the attribute Key conforming to the + // "heroku.release.creation_timestamp" semantic conventions. It represents the + // time and date the release was created. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2022-10-23T18:00:42Z" + HerokuReleaseCreationTimestampKey = attribute.Key("heroku.release.creation_timestamp") +) + +// HerokuAppID returns an attribute KeyValue conforming to the "heroku.app.id" +// semantic conventions. It represents the unique identifier for the application. +func HerokuAppID(val string) attribute.KeyValue { + return HerokuAppIDKey.String(val) +} + +// HerokuReleaseCommit returns an attribute KeyValue conforming to the +// "heroku.release.commit" semantic conventions. It represents the commit hash +// for the current release. +func HerokuReleaseCommit(val string) attribute.KeyValue { + return HerokuReleaseCommitKey.String(val) +} + +// HerokuReleaseCreationTimestamp returns an attribute KeyValue conforming to the +// "heroku.release.creation_timestamp" semantic conventions. It represents the +// time and date the release was created. +func HerokuReleaseCreationTimestamp(val string) attribute.KeyValue { + return HerokuReleaseCreationTimestampKey.String(val) +} + +// Namespace: host +const ( + // HostArchKey is the attribute Key conforming to the "host.arch" semantic + // conventions. It represents the CPU architecture the host system is running + // on. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + HostArchKey = attribute.Key("host.arch") + + // HostCPUCacheL2SizeKey is the attribute Key conforming to the + // "host.cpu.cache.l2.size" semantic conventions. It represents the amount of + // level 2 memory cache available to the processor (in Bytes). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12288000 + HostCPUCacheL2SizeKey = attribute.Key("host.cpu.cache.l2.size") + + // HostCPUFamilyKey is the attribute Key conforming to the "host.cpu.family" + // semantic conventions. It represents the family or generation of the CPU. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "6", "PA-RISC 1.1e" + HostCPUFamilyKey = attribute.Key("host.cpu.family") + + // HostCPUModelIDKey is the attribute Key conforming to the "host.cpu.model.id" + // semantic conventions. It represents the model identifier. It provides more + // granular information about the CPU, distinguishing it from other CPUs within + // the same family. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "6", "9000/778/B180L" + HostCPUModelIDKey = attribute.Key("host.cpu.model.id") + + // HostCPUModelNameKey is the attribute Key conforming to the + // "host.cpu.model.name" semantic conventions. It represents the model + // designation of the processor. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "11th Gen Intel(R) Core(TM) i7-1185G7 @ 3.00GHz" + HostCPUModelNameKey = attribute.Key("host.cpu.model.name") + + // HostCPUSteppingKey is the attribute Key conforming to the "host.cpu.stepping" + // semantic conventions. It represents the stepping or core revisions. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1", "r1p1" + HostCPUSteppingKey = attribute.Key("host.cpu.stepping") + + // HostCPUVendorIDKey is the attribute Key conforming to the + // "host.cpu.vendor.id" semantic conventions. It represents the processor + // manufacturer identifier. A maximum 12-character string. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "GenuineIntel" + // Note: [CPUID] command returns the vendor ID string in EBX, EDX and ECX + // registers. Writing these to memory in this order results in a 12-character + // string. + // + // [CPUID]: https://wiki.osdev.org/CPUID + HostCPUVendorIDKey = attribute.Key("host.cpu.vendor.id") + + // HostIDKey is the attribute Key conforming to the "host.id" semantic + // conventions. It represents the unique host ID. For Cloud, this must be the + // instance_id assigned by the cloud provider. For non-containerized systems, + // this should be the `machine-id`. See the table below for the sources to use + // to determine the `machine-id` based on operating system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "fdbf79e8af94cb7f9e8df36789187052" + HostIDKey = attribute.Key("host.id") + + // HostImageIDKey is the attribute Key conforming to the "host.image.id" + // semantic conventions. It represents the VM image ID or host OS image ID. For + // Cloud, this value is from the provider. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ami-07b06b442921831e5" + HostImageIDKey = attribute.Key("host.image.id") + + // HostImageNameKey is the attribute Key conforming to the "host.image.name" + // semantic conventions. It represents the name of the VM image or OS install + // the host was instantiated from. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "infra-ami-eks-worker-node-7d4ec78312", "CentOS-8-x86_64-1905" + HostImageNameKey = attribute.Key("host.image.name") + + // HostImageVersionKey is the attribute Key conforming to the + // "host.image.version" semantic conventions. It represents the version string + // of the VM image or host OS as defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0.1" + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + HostImageVersionKey = attribute.Key("host.image.version") + + // HostIPKey is the attribute Key conforming to the "host.ip" semantic + // conventions. It represents the available IP addresses of the host, excluding + // loopback interfaces. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "192.168.1.140", "fe80::abc2:4a28:737a:609e" + // Note: IPv4 Addresses MUST be specified in dotted-quad notation. IPv6 + // addresses MUST be specified in the [RFC 5952] format. + // + // [RFC 5952]: https://www.rfc-editor.org/rfc/rfc5952.html + HostIPKey = attribute.Key("host.ip") + + // HostMacKey is the attribute Key conforming to the "host.mac" semantic + // conventions. It represents the available MAC addresses of the host, excluding + // loopback interfaces. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "AC-DE-48-23-45-67", "AC-DE-48-23-45-67-01-9F" + // Note: MAC Addresses MUST be represented in [IEEE RA hexadecimal form]: as + // hyphen-separated octets in uppercase hexadecimal form from most to least + // significant. + // + // [IEEE RA hexadecimal form]: https://standards.ieee.org/wp-content/uploads/import/documents/tutorials/eui.pdf + HostMacKey = attribute.Key("host.mac") + + // HostNameKey is the attribute Key conforming to the "host.name" semantic + // conventions. It represents the name of the host. On Unix systems, it may + // contain what the hostname command returns, or the fully qualified hostname, + // or another name specified by the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-test" + HostNameKey = attribute.Key("host.name") + + // HostTypeKey is the attribute Key conforming to the "host.type" semantic + // conventions. It represents the type of host. For Cloud, this must be the + // machine type. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "n1-standard-1" + HostTypeKey = attribute.Key("host.type") +) + +// HostCPUCacheL2Size returns an attribute KeyValue conforming to the +// "host.cpu.cache.l2.size" semantic conventions. It represents the amount of +// level 2 memory cache available to the processor (in Bytes). +func HostCPUCacheL2Size(val int) attribute.KeyValue { + return HostCPUCacheL2SizeKey.Int(val) +} + +// HostCPUFamily returns an attribute KeyValue conforming to the +// "host.cpu.family" semantic conventions. It represents the family or generation +// of the CPU. +func HostCPUFamily(val string) attribute.KeyValue { + return HostCPUFamilyKey.String(val) +} + +// HostCPUModelID returns an attribute KeyValue conforming to the +// "host.cpu.model.id" semantic conventions. It represents the model identifier. +// It provides more granular information about the CPU, distinguishing it from +// other CPUs within the same family. +func HostCPUModelID(val string) attribute.KeyValue { + return HostCPUModelIDKey.String(val) +} + +// HostCPUModelName returns an attribute KeyValue conforming to the +// "host.cpu.model.name" semantic conventions. It represents the model +// designation of the processor. +func HostCPUModelName(val string) attribute.KeyValue { + return HostCPUModelNameKey.String(val) +} + +// HostCPUStepping returns an attribute KeyValue conforming to the +// "host.cpu.stepping" semantic conventions. It represents the stepping or core +// revisions. +func HostCPUStepping(val string) attribute.KeyValue { + return HostCPUSteppingKey.String(val) +} + +// HostCPUVendorID returns an attribute KeyValue conforming to the +// "host.cpu.vendor.id" semantic conventions. It represents the processor +// manufacturer identifier. A maximum 12-character string. +func HostCPUVendorID(val string) attribute.KeyValue { + return HostCPUVendorIDKey.String(val) +} + +// HostID returns an attribute KeyValue conforming to the "host.id" semantic +// conventions. It represents the unique host ID. For Cloud, this must be the +// instance_id assigned by the cloud provider. For non-containerized systems, +// this should be the `machine-id`. See the table below for the sources to use to +// determine the `machine-id` based on operating system. +func HostID(val string) attribute.KeyValue { + return HostIDKey.String(val) +} + +// HostImageID returns an attribute KeyValue conforming to the "host.image.id" +// semantic conventions. It represents the VM image ID or host OS image ID. For +// Cloud, this value is from the provider. +func HostImageID(val string) attribute.KeyValue { + return HostImageIDKey.String(val) +} + +// HostImageName returns an attribute KeyValue conforming to the +// "host.image.name" semantic conventions. It represents the name of the VM image +// or OS install the host was instantiated from. +func HostImageName(val string) attribute.KeyValue { + return HostImageNameKey.String(val) +} + +// HostImageVersion returns an attribute KeyValue conforming to the +// "host.image.version" semantic conventions. It represents the version string of +// the VM image or host OS as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func HostImageVersion(val string) attribute.KeyValue { + return HostImageVersionKey.String(val) +} + +// HostIP returns an attribute KeyValue conforming to the "host.ip" semantic +// conventions. It represents the available IP addresses of the host, excluding +// loopback interfaces. +func HostIP(val ...string) attribute.KeyValue { + return HostIPKey.StringSlice(val) +} + +// HostMac returns an attribute KeyValue conforming to the "host.mac" semantic +// conventions. It represents the available MAC addresses of the host, excluding +// loopback interfaces. +func HostMac(val ...string) attribute.KeyValue { + return HostMacKey.StringSlice(val) +} + +// HostName returns an attribute KeyValue conforming to the "host.name" semantic +// conventions. It represents the name of the host. On Unix systems, it may +// contain what the hostname command returns, or the fully qualified hostname, or +// another name specified by the user. +func HostName(val string) attribute.KeyValue { + return HostNameKey.String(val) +} + +// HostType returns an attribute KeyValue conforming to the "host.type" semantic +// conventions. It represents the type of host. For Cloud, this must be the +// machine type. +func HostType(val string) attribute.KeyValue { + return HostTypeKey.String(val) +} + +// Enum values for host.arch +var ( + // AMD64 + // Stability: development + HostArchAMD64 = HostArchKey.String("amd64") + // ARM32 + // Stability: development + HostArchARM32 = HostArchKey.String("arm32") + // ARM64 + // Stability: development + HostArchARM64 = HostArchKey.String("arm64") + // Itanium + // Stability: development + HostArchIA64 = HostArchKey.String("ia64") + // 32-bit PowerPC + // Stability: development + HostArchPPC32 = HostArchKey.String("ppc32") + // 64-bit PowerPC + // Stability: development + HostArchPPC64 = HostArchKey.String("ppc64") + // IBM z/Architecture + // Stability: development + HostArchS390x = HostArchKey.String("s390x") + // 32-bit x86 + // Stability: development + HostArchX86 = HostArchKey.String("x86") +) + +// Namespace: http +const ( + // HTTPConnectionStateKey is the attribute Key conforming to the + // "http.connection.state" semantic conventions. It represents the state of the + // HTTP connection in the HTTP connection pool. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "active", "idle" + HTTPConnectionStateKey = attribute.Key("http.connection.state") + + // HTTPRequestBodySizeKey is the attribute Key conforming to the + // "http.request.body.size" semantic conventions. It represents the size of the + // request payload body in bytes. This is the number of bytes transferred + // excluding headers and is often, but not always, present as the + // [Content-Length] header. For requests using transport encoding, this should + // be the compressed size. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length + HTTPRequestBodySizeKey = attribute.Key("http.request.body.size") + + // HTTPRequestMethodKey is the attribute Key conforming to the + // "http.request.method" semantic conventions. It represents the HTTP request + // method. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GET", "POST", "HEAD" + // Note: HTTP request method value SHOULD be "known" to the instrumentation. + // By default, this convention defines "known" methods as the ones listed in + // [RFC9110] + // and the PATCH method defined in [RFC5789]. + // + // If the HTTP request method is not known to instrumentation, it MUST set the + // `http.request.method` attribute to `_OTHER`. + // + // If the HTTP instrumentation could end up converting valid HTTP request + // methods to `_OTHER`, then it MUST provide a way to override + // the list of known HTTP methods. If this override is done via environment + // variable, then the environment variable MUST be named + // OTEL_INSTRUMENTATION_HTTP_KNOWN_METHODS and support a comma-separated list of + // case-sensitive known HTTP methods + // (this list MUST be a full override of the default known method, it is not a + // list of known methods in addition to the defaults). + // + // HTTP method names are case-sensitive and `http.request.method` attribute + // value MUST match a known HTTP method name exactly. + // Instrumentations for specific web frameworks that consider HTTP methods to be + // case insensitive, SHOULD populate a canonical equivalent. + // Tracing instrumentations that do so, MUST also set + // `http.request.method_original` to the original value. + // + // [RFC9110]: https://www.rfc-editor.org/rfc/rfc9110.html#name-methods + // [RFC5789]: https://www.rfc-editor.org/rfc/rfc5789.html + HTTPRequestMethodKey = attribute.Key("http.request.method") + + // HTTPRequestMethodOriginalKey is the attribute Key conforming to the + // "http.request.method_original" semantic conventions. It represents the + // original HTTP method sent by the client in the request line. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GeT", "ACL", "foo" + HTTPRequestMethodOriginalKey = attribute.Key("http.request.method_original") + + // HTTPRequestResendCountKey is the attribute Key conforming to the + // "http.request.resend_count" semantic conventions. It represents the ordinal + // number of request resending attempt (for any reason, including redirects). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Note: The resend count SHOULD be updated each time an HTTP request gets + // resent by the client, regardless of what was the cause of the resending (e.g. + // redirection, authorization failure, 503 Server Unavailable, network issues, + // or any other). + HTTPRequestResendCountKey = attribute.Key("http.request.resend_count") + + // HTTPRequestSizeKey is the attribute Key conforming to the "http.request.size" + // semantic conventions. It represents the total size of the request in bytes. + // This should be the total number of bytes sent over the wire, including the + // request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, and request + // body if any. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + HTTPRequestSizeKey = attribute.Key("http.request.size") + + // HTTPResponseBodySizeKey is the attribute Key conforming to the + // "http.response.body.size" semantic conventions. It represents the size of the + // response payload body in bytes. This is the number of bytes transferred + // excluding headers and is often, but not always, present as the + // [Content-Length] header. For requests using transport encoding, this should + // be the compressed size. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length + HTTPResponseBodySizeKey = attribute.Key("http.response.body.size") + + // HTTPResponseSizeKey is the attribute Key conforming to the + // "http.response.size" semantic conventions. It represents the total size of + // the response in bytes. This should be the total number of bytes sent over the + // wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3), + // headers, and response body and trailers if any. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + HTTPResponseSizeKey = attribute.Key("http.response.size") + + // HTTPResponseStatusCodeKey is the attribute Key conforming to the + // "http.response.status_code" semantic conventions. It represents the + // [HTTP response status code]. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 200 + // + // [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6 + HTTPResponseStatusCodeKey = attribute.Key("http.response.status_code") + + // HTTPRouteKey is the attribute Key conforming to the "http.route" semantic + // conventions. It represents the matched route, that is, the path template in + // the format used by the respective server framework. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "/users/:userID?", "{controller}/{action}/{id?}" + // Note: MUST NOT be populated when this is not supported by the HTTP server + // framework as the route attribute should have low-cardinality and the URI path + // can NOT substitute it. + // SHOULD include the [application root] if there is one. + // + // [application root]: /docs/http/http-spans.md#http-server-definitions + HTTPRouteKey = attribute.Key("http.route") +) + +// HTTPRequestBodySize returns an attribute KeyValue conforming to the +// "http.request.body.size" semantic conventions. It represents the size of the +// request payload body in bytes. This is the number of bytes transferred +// excluding headers and is often, but not always, present as the +// [Content-Length] header. For requests using transport encoding, this should be +// the compressed size. +// +// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length +func HTTPRequestBodySize(val int) attribute.KeyValue { + return HTTPRequestBodySizeKey.Int(val) +} + +// HTTPRequestMethodOriginal returns an attribute KeyValue conforming to the +// "http.request.method_original" semantic conventions. It represents the +// original HTTP method sent by the client in the request line. +func HTTPRequestMethodOriginal(val string) attribute.KeyValue { + return HTTPRequestMethodOriginalKey.String(val) +} + +// HTTPRequestResendCount returns an attribute KeyValue conforming to the +// "http.request.resend_count" semantic conventions. It represents the ordinal +// number of request resending attempt (for any reason, including redirects). +func HTTPRequestResendCount(val int) attribute.KeyValue { + return HTTPRequestResendCountKey.Int(val) +} + +// HTTPRequestSize returns an attribute KeyValue conforming to the +// "http.request.size" semantic conventions. It represents the total size of the +// request in bytes. This should be the total number of bytes sent over the wire, +// including the request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, +// and request body if any. +func HTTPRequestSize(val int) attribute.KeyValue { + return HTTPRequestSizeKey.Int(val) +} + +// HTTPResponseBodySize returns an attribute KeyValue conforming to the +// "http.response.body.size" semantic conventions. It represents the size of the +// response payload body in bytes. This is the number of bytes transferred +// excluding headers and is often, but not always, present as the +// [Content-Length] header. For requests using transport encoding, this should be +// the compressed size. +// +// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length +func HTTPResponseBodySize(val int) attribute.KeyValue { + return HTTPResponseBodySizeKey.Int(val) +} + +// HTTPResponseSize returns an attribute KeyValue conforming to the +// "http.response.size" semantic conventions. It represents the total size of the +// response in bytes. This should be the total number of bytes sent over the +// wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3), +// headers, and response body and trailers if any. +func HTTPResponseSize(val int) attribute.KeyValue { + return HTTPResponseSizeKey.Int(val) +} + +// HTTPResponseStatusCode returns an attribute KeyValue conforming to the +// "http.response.status_code" semantic conventions. It represents the +// [HTTP response status code]. +// +// [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6 +func HTTPResponseStatusCode(val int) attribute.KeyValue { + return HTTPResponseStatusCodeKey.Int(val) +} + +// HTTPRoute returns an attribute KeyValue conforming to the "http.route" +// semantic conventions. It represents the matched route, that is, the path +// template in the format used by the respective server framework. +func HTTPRoute(val string) attribute.KeyValue { + return HTTPRouteKey.String(val) +} + +// Enum values for http.connection.state +var ( + // active state. + // Stability: development + HTTPConnectionStateActive = HTTPConnectionStateKey.String("active") + // idle state. + // Stability: development + HTTPConnectionStateIdle = HTTPConnectionStateKey.String("idle") +) + +// Enum values for http.request.method +var ( + // CONNECT method. + // Stability: stable + HTTPRequestMethodConnect = HTTPRequestMethodKey.String("CONNECT") + // DELETE method. + // Stability: stable + HTTPRequestMethodDelete = HTTPRequestMethodKey.String("DELETE") + // GET method. + // Stability: stable + HTTPRequestMethodGet = HTTPRequestMethodKey.String("GET") + // HEAD method. + // Stability: stable + HTTPRequestMethodHead = HTTPRequestMethodKey.String("HEAD") + // OPTIONS method. + // Stability: stable + HTTPRequestMethodOptions = HTTPRequestMethodKey.String("OPTIONS") + // PATCH method. + // Stability: stable + HTTPRequestMethodPatch = HTTPRequestMethodKey.String("PATCH") + // POST method. + // Stability: stable + HTTPRequestMethodPost = HTTPRequestMethodKey.String("POST") + // PUT method. + // Stability: stable + HTTPRequestMethodPut = HTTPRequestMethodKey.String("PUT") + // TRACE method. + // Stability: stable + HTTPRequestMethodTrace = HTTPRequestMethodKey.String("TRACE") + // Any HTTP method that the instrumentation has no prior knowledge of. + // Stability: stable + HTTPRequestMethodOther = HTTPRequestMethodKey.String("_OTHER") +) + +// Namespace: hw +const ( + // HwIDKey is the attribute Key conforming to the "hw.id" semantic conventions. + // It represents an identifier for the hardware component, unique within the + // monitored host. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "win32battery_battery_testsysa33_1" + HwIDKey = attribute.Key("hw.id") + + // HwNameKey is the attribute Key conforming to the "hw.name" semantic + // conventions. It represents an easily-recognizable name for the hardware + // component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "eth0" + HwNameKey = attribute.Key("hw.name") + + // HwParentKey is the attribute Key conforming to the "hw.parent" semantic + // conventions. It represents the unique identifier of the parent component + // (typically the `hw.id` attribute of the enclosure, or disk controller). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "dellStorage_perc_0" + HwParentKey = attribute.Key("hw.parent") + + // HwStateKey is the attribute Key conforming to the "hw.state" semantic + // conventions. It represents the current state of the component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + HwStateKey = attribute.Key("hw.state") + + // HwTypeKey is the attribute Key conforming to the "hw.type" semantic + // conventions. It represents the type of the component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: Describes the category of the hardware component for which `hw.state` + // is being reported. For example, `hw.type=temperature` along with + // `hw.state=degraded` would indicate that the temperature of the hardware + // component has been reported as `degraded`. + HwTypeKey = attribute.Key("hw.type") +) + +// HwID returns an attribute KeyValue conforming to the "hw.id" semantic +// conventions. It represents an identifier for the hardware component, unique +// within the monitored host. +func HwID(val string) attribute.KeyValue { + return HwIDKey.String(val) +} + +// HwName returns an attribute KeyValue conforming to the "hw.name" semantic +// conventions. It represents an easily-recognizable name for the hardware +// component. +func HwName(val string) attribute.KeyValue { + return HwNameKey.String(val) +} + +// HwParent returns an attribute KeyValue conforming to the "hw.parent" semantic +// conventions. It represents the unique identifier of the parent component +// (typically the `hw.id` attribute of the enclosure, or disk controller). +func HwParent(val string) attribute.KeyValue { + return HwParentKey.String(val) +} + +// Enum values for hw.state +var ( + // Ok + // Stability: development + HwStateOk = HwStateKey.String("ok") + // Degraded + // Stability: development + HwStateDegraded = HwStateKey.String("degraded") + // Failed + // Stability: development + HwStateFailed = HwStateKey.String("failed") +) + +// Enum values for hw.type +var ( + // Battery + // Stability: development + HwTypeBattery = HwTypeKey.String("battery") + // CPU + // Stability: development + HwTypeCPU = HwTypeKey.String("cpu") + // Disk controller + // Stability: development + HwTypeDiskController = HwTypeKey.String("disk_controller") + // Enclosure + // Stability: development + HwTypeEnclosure = HwTypeKey.String("enclosure") + // Fan + // Stability: development + HwTypeFan = HwTypeKey.String("fan") + // GPU + // Stability: development + HwTypeGpu = HwTypeKey.String("gpu") + // Logical disk + // Stability: development + HwTypeLogicalDisk = HwTypeKey.String("logical_disk") + // Memory + // Stability: development + HwTypeMemory = HwTypeKey.String("memory") + // Network + // Stability: development + HwTypeNetwork = HwTypeKey.String("network") + // Physical disk + // Stability: development + HwTypePhysicalDisk = HwTypeKey.String("physical_disk") + // Power supply + // Stability: development + HwTypePowerSupply = HwTypeKey.String("power_supply") + // Tape drive + // Stability: development + HwTypeTapeDrive = HwTypeKey.String("tape_drive") + // Temperature + // Stability: development + HwTypeTemperature = HwTypeKey.String("temperature") + // Voltage + // Stability: development + HwTypeVoltage = HwTypeKey.String("voltage") +) + +// Namespace: ios +const ( + // IOSAppStateKey is the attribute Key conforming to the "ios.app.state" + // semantic conventions. It represents the this attribute represents the state + // of the application. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The iOS lifecycle states are defined in the + // [UIApplicationDelegate documentation], and from which the `OS terminology` + // column values are derived. + // + // [UIApplicationDelegate documentation]: https://developer.apple.com/documentation/uikit/uiapplicationdelegate + IOSAppStateKey = attribute.Key("ios.app.state") +) + +// Enum values for ios.app.state +var ( + // The app has become `active`. Associated with UIKit notification + // `applicationDidBecomeActive`. + // + // Stability: development + IOSAppStateActive = IOSAppStateKey.String("active") + // The app is now `inactive`. Associated with UIKit notification + // `applicationWillResignActive`. + // + // Stability: development + IOSAppStateInactive = IOSAppStateKey.String("inactive") + // The app is now in the background. This value is associated with UIKit + // notification `applicationDidEnterBackground`. + // + // Stability: development + IOSAppStateBackground = IOSAppStateKey.String("background") + // The app is now in the foreground. This value is associated with UIKit + // notification `applicationWillEnterForeground`. + // + // Stability: development + IOSAppStateForeground = IOSAppStateKey.String("foreground") + // The app is about to terminate. Associated with UIKit notification + // `applicationWillTerminate`. + // + // Stability: development + IOSAppStateTerminate = IOSAppStateKey.String("terminate") +) + +// Namespace: k8s +const ( + // K8SClusterNameKey is the attribute Key conforming to the "k8s.cluster.name" + // semantic conventions. It represents the name of the cluster. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-cluster" + K8SClusterNameKey = attribute.Key("k8s.cluster.name") + + // K8SClusterUIDKey is the attribute Key conforming to the "k8s.cluster.uid" + // semantic conventions. It represents a pseudo-ID for the cluster, set to the + // UID of the `kube-system` namespace. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: K8s doesn't have support for obtaining a cluster ID. If this is ever + // added, we will recommend collecting the `k8s.cluster.uid` through the + // official APIs. In the meantime, we are able to use the `uid` of the + // `kube-system` namespace as a proxy for cluster ID. Read on for the + // rationale. + // + // Every object created in a K8s cluster is assigned a distinct UID. The + // `kube-system` namespace is used by Kubernetes itself and will exist + // for the lifetime of the cluster. Using the `uid` of the `kube-system` + // namespace is a reasonable proxy for the K8s ClusterID as it will only + // change if the cluster is rebuilt. Furthermore, Kubernetes UIDs are + // UUIDs as standardized by + // [ISO/IEC 9834-8 and ITU-T X.667]. + // Which states: + // + // > If generated according to one of the mechanisms defined in Rec. + // > ITU-T X.667 | ISO/IEC 9834-8, a UUID is either guaranteed to be + // > different from all other UUIDs generated before 3603 A.D., or is + // > extremely likely to be different (depending on the mechanism chosen). + // + // Therefore, UIDs between clusters should be extremely unlikely to + // conflict. + // + // [ISO/IEC 9834-8 and ITU-T X.667]: https://www.itu.int/ITU-T/studygroups/com17/oid.html + K8SClusterUIDKey = attribute.Key("k8s.cluster.uid") + + // K8SContainerNameKey is the attribute Key conforming to the + // "k8s.container.name" semantic conventions. It represents the name of the + // Container from Pod specification, must be unique within a Pod. Container + // runtime usually uses different globally unique name (`container.name`). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "redis" + K8SContainerNameKey = attribute.Key("k8s.container.name") + + // K8SContainerRestartCountKey is the attribute Key conforming to the + // "k8s.container.restart_count" semantic conventions. It represents the number + // of times the container was restarted. This attribute can be used to identify + // a particular container (running or stopped) within a container spec. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + K8SContainerRestartCountKey = attribute.Key("k8s.container.restart_count") + + // K8SContainerStatusLastTerminatedReasonKey is the attribute Key conforming to + // the "k8s.container.status.last_terminated_reason" semantic conventions. It + // represents the last terminated reason of the Container. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Evicted", "Error" + K8SContainerStatusLastTerminatedReasonKey = attribute.Key("k8s.container.status.last_terminated_reason") + + // K8SCronJobNameKey is the attribute Key conforming to the "k8s.cronjob.name" + // semantic conventions. It represents the name of the CronJob. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SCronJobNameKey = attribute.Key("k8s.cronjob.name") + + // K8SCronJobUIDKey is the attribute Key conforming to the "k8s.cronjob.uid" + // semantic conventions. It represents the UID of the CronJob. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SCronJobUIDKey = attribute.Key("k8s.cronjob.uid") + + // K8SDaemonSetNameKey is the attribute Key conforming to the + // "k8s.daemonset.name" semantic conventions. It represents the name of the + // DaemonSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SDaemonSetNameKey = attribute.Key("k8s.daemonset.name") + + // K8SDaemonSetUIDKey is the attribute Key conforming to the "k8s.daemonset.uid" + // semantic conventions. It represents the UID of the DaemonSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SDaemonSetUIDKey = attribute.Key("k8s.daemonset.uid") + + // K8SDeploymentNameKey is the attribute Key conforming to the + // "k8s.deployment.name" semantic conventions. It represents the name of the + // Deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SDeploymentNameKey = attribute.Key("k8s.deployment.name") + + // K8SDeploymentUIDKey is the attribute Key conforming to the + // "k8s.deployment.uid" semantic conventions. It represents the UID of the + // Deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SDeploymentUIDKey = attribute.Key("k8s.deployment.uid") + + // K8SHPANameKey is the attribute Key conforming to the "k8s.hpa.name" semantic + // conventions. It represents the name of the horizontal pod autoscaler. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SHPANameKey = attribute.Key("k8s.hpa.name") + + // K8SHPAUIDKey is the attribute Key conforming to the "k8s.hpa.uid" semantic + // conventions. It represents the UID of the horizontal pod autoscaler. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SHPAUIDKey = attribute.Key("k8s.hpa.uid") + + // K8SJobNameKey is the attribute Key conforming to the "k8s.job.name" semantic + // conventions. It represents the name of the Job. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SJobNameKey = attribute.Key("k8s.job.name") + + // K8SJobUIDKey is the attribute Key conforming to the "k8s.job.uid" semantic + // conventions. It represents the UID of the Job. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SJobUIDKey = attribute.Key("k8s.job.uid") + + // K8SNamespaceNameKey is the attribute Key conforming to the + // "k8s.namespace.name" semantic conventions. It represents the name of the + // namespace that the pod is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "default" + K8SNamespaceNameKey = attribute.Key("k8s.namespace.name") + + // K8SNamespacePhaseKey is the attribute Key conforming to the + // "k8s.namespace.phase" semantic conventions. It represents the phase of the + // K8s namespace. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "active", "terminating" + // Note: This attribute aligns with the `phase` field of the + // [K8s NamespaceStatus] + // + // [K8s NamespaceStatus]: https://kubernetes.io/docs/reference/generated/kubernetes-api/v1.30/#namespacestatus-v1-core + K8SNamespacePhaseKey = attribute.Key("k8s.namespace.phase") + + // K8SNodeNameKey is the attribute Key conforming to the "k8s.node.name" + // semantic conventions. It represents the name of the Node. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "node-1" + K8SNodeNameKey = attribute.Key("k8s.node.name") + + // K8SNodeUIDKey is the attribute Key conforming to the "k8s.node.uid" semantic + // conventions. It represents the UID of the Node. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1eb3a0c6-0477-4080-a9cb-0cb7db65c6a2" + K8SNodeUIDKey = attribute.Key("k8s.node.uid") + + // K8SPodNameKey is the attribute Key conforming to the "k8s.pod.name" semantic + // conventions. It represents the name of the Pod. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-pod-autoconf" + K8SPodNameKey = attribute.Key("k8s.pod.name") + + // K8SPodUIDKey is the attribute Key conforming to the "k8s.pod.uid" semantic + // conventions. It represents the UID of the Pod. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SPodUIDKey = attribute.Key("k8s.pod.uid") + + // K8SReplicaSetNameKey is the attribute Key conforming to the + // "k8s.replicaset.name" semantic conventions. It represents the name of the + // ReplicaSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SReplicaSetNameKey = attribute.Key("k8s.replicaset.name") + + // K8SReplicaSetUIDKey is the attribute Key conforming to the + // "k8s.replicaset.uid" semantic conventions. It represents the UID of the + // ReplicaSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SReplicaSetUIDKey = attribute.Key("k8s.replicaset.uid") + + // K8SReplicationControllerNameKey is the attribute Key conforming to the + // "k8s.replicationcontroller.name" semantic conventions. It represents the name + // of the replication controller. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SReplicationControllerNameKey = attribute.Key("k8s.replicationcontroller.name") + + // K8SReplicationControllerUIDKey is the attribute Key conforming to the + // "k8s.replicationcontroller.uid" semantic conventions. It represents the UID + // of the replication controller. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SReplicationControllerUIDKey = attribute.Key("k8s.replicationcontroller.uid") + + // K8SResourceQuotaNameKey is the attribute Key conforming to the + // "k8s.resourcequota.name" semantic conventions. It represents the name of the + // resource quota. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SResourceQuotaNameKey = attribute.Key("k8s.resourcequota.name") + + // K8SResourceQuotaUIDKey is the attribute Key conforming to the + // "k8s.resourcequota.uid" semantic conventions. It represents the UID of the + // resource quota. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SResourceQuotaUIDKey = attribute.Key("k8s.resourcequota.uid") + + // K8SStatefulSetNameKey is the attribute Key conforming to the + // "k8s.statefulset.name" semantic conventions. It represents the name of the + // StatefulSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SStatefulSetNameKey = attribute.Key("k8s.statefulset.name") + + // K8SStatefulSetUIDKey is the attribute Key conforming to the + // "k8s.statefulset.uid" semantic conventions. It represents the UID of the + // StatefulSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SStatefulSetUIDKey = attribute.Key("k8s.statefulset.uid") + + // K8SVolumeNameKey is the attribute Key conforming to the "k8s.volume.name" + // semantic conventions. It represents the name of the K8s volume. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "volume0" + K8SVolumeNameKey = attribute.Key("k8s.volume.name") + + // K8SVolumeTypeKey is the attribute Key conforming to the "k8s.volume.type" + // semantic conventions. It represents the type of the K8s volume. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "emptyDir", "persistentVolumeClaim" + K8SVolumeTypeKey = attribute.Key("k8s.volume.type") +) + +// K8SClusterName returns an attribute KeyValue conforming to the +// "k8s.cluster.name" semantic conventions. It represents the name of the +// cluster. +func K8SClusterName(val string) attribute.KeyValue { + return K8SClusterNameKey.String(val) +} + +// K8SClusterUID returns an attribute KeyValue conforming to the +// "k8s.cluster.uid" semantic conventions. It represents a pseudo-ID for the +// cluster, set to the UID of the `kube-system` namespace. +func K8SClusterUID(val string) attribute.KeyValue { + return K8SClusterUIDKey.String(val) +} + +// K8SContainerName returns an attribute KeyValue conforming to the +// "k8s.container.name" semantic conventions. It represents the name of the +// Container from Pod specification, must be unique within a Pod. Container +// runtime usually uses different globally unique name (`container.name`). +func K8SContainerName(val string) attribute.KeyValue { + return K8SContainerNameKey.String(val) +} + +// K8SContainerRestartCount returns an attribute KeyValue conforming to the +// "k8s.container.restart_count" semantic conventions. It represents the number +// of times the container was restarted. This attribute can be used to identify a +// particular container (running or stopped) within a container spec. +func K8SContainerRestartCount(val int) attribute.KeyValue { + return K8SContainerRestartCountKey.Int(val) +} + +// K8SContainerStatusLastTerminatedReason returns an attribute KeyValue +// conforming to the "k8s.container.status.last_terminated_reason" semantic +// conventions. It represents the last terminated reason of the Container. +func K8SContainerStatusLastTerminatedReason(val string) attribute.KeyValue { + return K8SContainerStatusLastTerminatedReasonKey.String(val) +} + +// K8SCronJobName returns an attribute KeyValue conforming to the +// "k8s.cronjob.name" semantic conventions. It represents the name of the +// CronJob. +func K8SCronJobName(val string) attribute.KeyValue { + return K8SCronJobNameKey.String(val) +} + +// K8SCronJobUID returns an attribute KeyValue conforming to the +// "k8s.cronjob.uid" semantic conventions. It represents the UID of the CronJob. +func K8SCronJobUID(val string) attribute.KeyValue { + return K8SCronJobUIDKey.String(val) +} + +// K8SDaemonSetName returns an attribute KeyValue conforming to the +// "k8s.daemonset.name" semantic conventions. It represents the name of the +// DaemonSet. +func K8SDaemonSetName(val string) attribute.KeyValue { + return K8SDaemonSetNameKey.String(val) +} + +// K8SDaemonSetUID returns an attribute KeyValue conforming to the +// "k8s.daemonset.uid" semantic conventions. It represents the UID of the +// DaemonSet. +func K8SDaemonSetUID(val string) attribute.KeyValue { + return K8SDaemonSetUIDKey.String(val) +} + +// K8SDeploymentName returns an attribute KeyValue conforming to the +// "k8s.deployment.name" semantic conventions. It represents the name of the +// Deployment. +func K8SDeploymentName(val string) attribute.KeyValue { + return K8SDeploymentNameKey.String(val) +} + +// K8SDeploymentUID returns an attribute KeyValue conforming to the +// "k8s.deployment.uid" semantic conventions. It represents the UID of the +// Deployment. +func K8SDeploymentUID(val string) attribute.KeyValue { + return K8SDeploymentUIDKey.String(val) +} + +// K8SHPAName returns an attribute KeyValue conforming to the "k8s.hpa.name" +// semantic conventions. It represents the name of the horizontal pod autoscaler. +func K8SHPAName(val string) attribute.KeyValue { + return K8SHPANameKey.String(val) +} + +// K8SHPAUID returns an attribute KeyValue conforming to the "k8s.hpa.uid" +// semantic conventions. It represents the UID of the horizontal pod autoscaler. +func K8SHPAUID(val string) attribute.KeyValue { + return K8SHPAUIDKey.String(val) +} + +// K8SJobName returns an attribute KeyValue conforming to the "k8s.job.name" +// semantic conventions. It represents the name of the Job. +func K8SJobName(val string) attribute.KeyValue { + return K8SJobNameKey.String(val) +} + +// K8SJobUID returns an attribute KeyValue conforming to the "k8s.job.uid" +// semantic conventions. It represents the UID of the Job. +func K8SJobUID(val string) attribute.KeyValue { + return K8SJobUIDKey.String(val) +} + +// K8SNamespaceName returns an attribute KeyValue conforming to the +// "k8s.namespace.name" semantic conventions. It represents the name of the +// namespace that the pod is running in. +func K8SNamespaceName(val string) attribute.KeyValue { + return K8SNamespaceNameKey.String(val) +} + +// K8SNodeName returns an attribute KeyValue conforming to the "k8s.node.name" +// semantic conventions. It represents the name of the Node. +func K8SNodeName(val string) attribute.KeyValue { + return K8SNodeNameKey.String(val) +} + +// K8SNodeUID returns an attribute KeyValue conforming to the "k8s.node.uid" +// semantic conventions. It represents the UID of the Node. +func K8SNodeUID(val string) attribute.KeyValue { + return K8SNodeUIDKey.String(val) +} + +// K8SPodName returns an attribute KeyValue conforming to the "k8s.pod.name" +// semantic conventions. It represents the name of the Pod. +func K8SPodName(val string) attribute.KeyValue { + return K8SPodNameKey.String(val) +} + +// K8SPodUID returns an attribute KeyValue conforming to the "k8s.pod.uid" +// semantic conventions. It represents the UID of the Pod. +func K8SPodUID(val string) attribute.KeyValue { + return K8SPodUIDKey.String(val) +} + +// K8SReplicaSetName returns an attribute KeyValue conforming to the +// "k8s.replicaset.name" semantic conventions. It represents the name of the +// ReplicaSet. +func K8SReplicaSetName(val string) attribute.KeyValue { + return K8SReplicaSetNameKey.String(val) +} + +// K8SReplicaSetUID returns an attribute KeyValue conforming to the +// "k8s.replicaset.uid" semantic conventions. It represents the UID of the +// ReplicaSet. +func K8SReplicaSetUID(val string) attribute.KeyValue { + return K8SReplicaSetUIDKey.String(val) +} + +// K8SReplicationControllerName returns an attribute KeyValue conforming to the +// "k8s.replicationcontroller.name" semantic conventions. It represents the name +// of the replication controller. +func K8SReplicationControllerName(val string) attribute.KeyValue { + return K8SReplicationControllerNameKey.String(val) +} + +// K8SReplicationControllerUID returns an attribute KeyValue conforming to the +// "k8s.replicationcontroller.uid" semantic conventions. It represents the UID of +// the replication controller. +func K8SReplicationControllerUID(val string) attribute.KeyValue { + return K8SReplicationControllerUIDKey.String(val) +} + +// K8SResourceQuotaName returns an attribute KeyValue conforming to the +// "k8s.resourcequota.name" semantic conventions. It represents the name of the +// resource quota. +func K8SResourceQuotaName(val string) attribute.KeyValue { + return K8SResourceQuotaNameKey.String(val) +} + +// K8SResourceQuotaUID returns an attribute KeyValue conforming to the +// "k8s.resourcequota.uid" semantic conventions. It represents the UID of the +// resource quota. +func K8SResourceQuotaUID(val string) attribute.KeyValue { + return K8SResourceQuotaUIDKey.String(val) +} + +// K8SStatefulSetName returns an attribute KeyValue conforming to the +// "k8s.statefulset.name" semantic conventions. It represents the name of the +// StatefulSet. +func K8SStatefulSetName(val string) attribute.KeyValue { + return K8SStatefulSetNameKey.String(val) +} + +// K8SStatefulSetUID returns an attribute KeyValue conforming to the +// "k8s.statefulset.uid" semantic conventions. It represents the UID of the +// StatefulSet. +func K8SStatefulSetUID(val string) attribute.KeyValue { + return K8SStatefulSetUIDKey.String(val) +} + +// K8SVolumeName returns an attribute KeyValue conforming to the +// "k8s.volume.name" semantic conventions. It represents the name of the K8s +// volume. +func K8SVolumeName(val string) attribute.KeyValue { + return K8SVolumeNameKey.String(val) +} + +// Enum values for k8s.namespace.phase +var ( + // Active namespace phase as described by [K8s API] + // Stability: development + // + // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase + K8SNamespacePhaseActive = K8SNamespacePhaseKey.String("active") + // Terminating namespace phase as described by [K8s API] + // Stability: development + // + // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase + K8SNamespacePhaseTerminating = K8SNamespacePhaseKey.String("terminating") +) + +// Enum values for k8s.volume.type +var ( + // A [persistentVolumeClaim] volume + // Stability: development + // + // [persistentVolumeClaim]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#persistentvolumeclaim + K8SVolumeTypePersistentVolumeClaim = K8SVolumeTypeKey.String("persistentVolumeClaim") + // A [configMap] volume + // Stability: development + // + // [configMap]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#configmap + K8SVolumeTypeConfigMap = K8SVolumeTypeKey.String("configMap") + // A [downwardAPI] volume + // Stability: development + // + // [downwardAPI]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#downwardapi + K8SVolumeTypeDownwardAPI = K8SVolumeTypeKey.String("downwardAPI") + // An [emptyDir] volume + // Stability: development + // + // [emptyDir]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#emptydir + K8SVolumeTypeEmptyDir = K8SVolumeTypeKey.String("emptyDir") + // A [secret] volume + // Stability: development + // + // [secret]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#secret + K8SVolumeTypeSecret = K8SVolumeTypeKey.String("secret") + // A [local] volume + // Stability: development + // + // [local]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#local + K8SVolumeTypeLocal = K8SVolumeTypeKey.String("local") +) + +// Namespace: linux +const ( + // LinuxMemorySlabStateKey is the attribute Key conforming to the + // "linux.memory.slab.state" semantic conventions. It represents the Linux Slab + // memory state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "reclaimable", "unreclaimable" + LinuxMemorySlabStateKey = attribute.Key("linux.memory.slab.state") +) + +// Enum values for linux.memory.slab.state +var ( + // reclaimable + // Stability: development + LinuxMemorySlabStateReclaimable = LinuxMemorySlabStateKey.String("reclaimable") + // unreclaimable + // Stability: development + LinuxMemorySlabStateUnreclaimable = LinuxMemorySlabStateKey.String("unreclaimable") +) + +// Namespace: log +const ( + // LogFileNameKey is the attribute Key conforming to the "log.file.name" + // semantic conventions. It represents the basename of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "audit.log" + LogFileNameKey = attribute.Key("log.file.name") + + // LogFileNameResolvedKey is the attribute Key conforming to the + // "log.file.name_resolved" semantic conventions. It represents the basename of + // the file, with symlinks resolved. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "uuid.log" + LogFileNameResolvedKey = attribute.Key("log.file.name_resolved") + + // LogFilePathKey is the attribute Key conforming to the "log.file.path" + // semantic conventions. It represents the full path to the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/var/log/mysql/audit.log" + LogFilePathKey = attribute.Key("log.file.path") + + // LogFilePathResolvedKey is the attribute Key conforming to the + // "log.file.path_resolved" semantic conventions. It represents the full path to + // the file, with symlinks resolved. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/var/lib/docker/uuid.log" + LogFilePathResolvedKey = attribute.Key("log.file.path_resolved") + + // LogIostreamKey is the attribute Key conforming to the "log.iostream" semantic + // conventions. It represents the stream associated with the log. See below for + // a list of well-known values. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + LogIostreamKey = attribute.Key("log.iostream") + + // LogRecordOriginalKey is the attribute Key conforming to the + // "log.record.original" semantic conventions. It represents the complete + // original Log Record. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "77 <86>1 2015-08-06T21:58:59.694Z 192.168.2.133 inactive - - - + // Something happened", "[INFO] 8/3/24 12:34:56 Something happened" + // Note: This value MAY be added when processing a Log Record which was + // originally transmitted as a string or equivalent data type AND the Body field + // of the Log Record does not contain the same value. (e.g. a syslog or a log + // record read from a file.) + LogRecordOriginalKey = attribute.Key("log.record.original") + + // LogRecordUIDKey is the attribute Key conforming to the "log.record.uid" + // semantic conventions. It represents a unique identifier for the Log Record. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "01ARZ3NDEKTSV4RRFFQ69G5FAV" + // Note: If an id is provided, other log records with the same id will be + // considered duplicates and can be removed safely. This means, that two + // distinguishable log records MUST have different values. + // The id MAY be an + // [Universally Unique Lexicographically Sortable Identifier (ULID)], but other + // identifiers (e.g. UUID) may be used as needed. + // + // [Universally Unique Lexicographically Sortable Identifier (ULID)]: https://github.com/ulid/spec + LogRecordUIDKey = attribute.Key("log.record.uid") +) + +// LogFileName returns an attribute KeyValue conforming to the "log.file.name" +// semantic conventions. It represents the basename of the file. +func LogFileName(val string) attribute.KeyValue { + return LogFileNameKey.String(val) +} + +// LogFileNameResolved returns an attribute KeyValue conforming to the +// "log.file.name_resolved" semantic conventions. It represents the basename of +// the file, with symlinks resolved. +func LogFileNameResolved(val string) attribute.KeyValue { + return LogFileNameResolvedKey.String(val) +} + +// LogFilePath returns an attribute KeyValue conforming to the "log.file.path" +// semantic conventions. It represents the full path to the file. +func LogFilePath(val string) attribute.KeyValue { + return LogFilePathKey.String(val) +} + +// LogFilePathResolved returns an attribute KeyValue conforming to the +// "log.file.path_resolved" semantic conventions. It represents the full path to +// the file, with symlinks resolved. +func LogFilePathResolved(val string) attribute.KeyValue { + return LogFilePathResolvedKey.String(val) +} + +// LogRecordOriginal returns an attribute KeyValue conforming to the +// "log.record.original" semantic conventions. It represents the complete +// original Log Record. +func LogRecordOriginal(val string) attribute.KeyValue { + return LogRecordOriginalKey.String(val) +} + +// LogRecordUID returns an attribute KeyValue conforming to the "log.record.uid" +// semantic conventions. It represents a unique identifier for the Log Record. +func LogRecordUID(val string) attribute.KeyValue { + return LogRecordUIDKey.String(val) +} + +// Enum values for log.iostream +var ( + // Logs from stdout stream + // Stability: development + LogIostreamStdout = LogIostreamKey.String("stdout") + // Events from stderr stream + // Stability: development + LogIostreamStderr = LogIostreamKey.String("stderr") +) + +// Namespace: messaging +const ( + // MessagingBatchMessageCountKey is the attribute Key conforming to the + // "messaging.batch.message_count" semantic conventions. It represents the + // number of messages sent, received, or processed in the scope of the batching + // operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 1, 2 + // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on + // spans that operate with a single message. When a messaging client library + // supports both batch and single-message API for the same operation, + // instrumentations SHOULD use `messaging.batch.message_count` for batching APIs + // and SHOULD NOT use it for single-message APIs. + MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count") + + // MessagingClientIDKey is the attribute Key conforming to the + // "messaging.client.id" semantic conventions. It represents a unique identifier + // for the client that consumes or produces a message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "client-5", "myhost@8742@s8083jm" + MessagingClientIDKey = attribute.Key("messaging.client.id") + + // MessagingConsumerGroupNameKey is the attribute Key conforming to the + // "messaging.consumer.group.name" semantic conventions. It represents the name + // of the consumer group with which a consumer is associated. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-group", "indexer" + // Note: Semantic conventions for individual messaging systems SHOULD document + // whether `messaging.consumer.group.name` is applicable and what it means in + // the context of that system. + MessagingConsumerGroupNameKey = attribute.Key("messaging.consumer.group.name") + + // MessagingDestinationAnonymousKey is the attribute Key conforming to the + // "messaging.destination.anonymous" semantic conventions. It represents a + // boolean that is true if the message destination is anonymous (could be + // unnamed or have auto-generated name). + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingDestinationAnonymousKey = attribute.Key("messaging.destination.anonymous") + + // MessagingDestinationNameKey is the attribute Key conforming to the + // "messaging.destination.name" semantic conventions. It represents the message + // destination name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MyQueue", "MyTopic" + // Note: Destination name SHOULD uniquely identify a specific queue, topic or + // other entity within the broker. If + // the broker doesn't have such notion, the destination name SHOULD uniquely + // identify the broker. + MessagingDestinationNameKey = attribute.Key("messaging.destination.name") + + // MessagingDestinationPartitionIDKey is the attribute Key conforming to the + // "messaging.destination.partition.id" semantic conventions. It represents the + // identifier of the partition messages are sent to or received from, unique + // within the `messaging.destination.name`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + MessagingDestinationPartitionIDKey = attribute.Key("messaging.destination.partition.id") + + // MessagingDestinationSubscriptionNameKey is the attribute Key conforming to + // the "messaging.destination.subscription.name" semantic conventions. It + // represents the name of the destination subscription from which a message is + // consumed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "subscription-a" + // Note: Semantic conventions for individual messaging systems SHOULD document + // whether `messaging.destination.subscription.name` is applicable and what it + // means in the context of that system. + MessagingDestinationSubscriptionNameKey = attribute.Key("messaging.destination.subscription.name") + + // MessagingDestinationTemplateKey is the attribute Key conforming to the + // "messaging.destination.template" semantic conventions. It represents the low + // cardinality representation of the messaging destination name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/customers/{customerId}" + // Note: Destination names could be constructed from templates. An example would + // be a destination name involving a user name or product id. Although the + // destination name in this case is of high cardinality, the underlying template + // is of low cardinality and can be effectively used for grouping and + // aggregation. + MessagingDestinationTemplateKey = attribute.Key("messaging.destination.template") + + // MessagingDestinationTemporaryKey is the attribute Key conforming to the + // "messaging.destination.temporary" semantic conventions. It represents a + // boolean that is true if the message destination is temporary and might not + // exist anymore after messages are processed. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingDestinationTemporaryKey = attribute.Key("messaging.destination.temporary") + + // MessagingEventHubsMessageEnqueuedTimeKey is the attribute Key conforming to + // the "messaging.eventhubs.message.enqueued_time" semantic conventions. It + // represents the UTC epoch seconds at which the message has been accepted and + // stored in the entity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingEventHubsMessageEnqueuedTimeKey = attribute.Key("messaging.eventhubs.message.enqueued_time") + + // MessagingGCPPubSubMessageAckDeadlineKey is the attribute Key conforming to + // the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It + // represents the ack deadline in seconds set for the modify ack deadline + // request. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingGCPPubSubMessageAckDeadlineKey = attribute.Key("messaging.gcp_pubsub.message.ack_deadline") + + // MessagingGCPPubSubMessageAckIDKey is the attribute Key conforming to the + // "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the + // ack id for a given message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: ack_id + MessagingGCPPubSubMessageAckIDKey = attribute.Key("messaging.gcp_pubsub.message.ack_id") + + // MessagingGCPPubSubMessageDeliveryAttemptKey is the attribute Key conforming + // to the "messaging.gcp_pubsub.message.delivery_attempt" semantic conventions. + // It represents the delivery attempt for a given message. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingGCPPubSubMessageDeliveryAttemptKey = attribute.Key("messaging.gcp_pubsub.message.delivery_attempt") + + // MessagingGCPPubSubMessageOrderingKeyKey is the attribute Key conforming to + // the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It + // represents the ordering key for a given message. If the attribute is not + // present, the message does not have an ordering key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: ordering_key + MessagingGCPPubSubMessageOrderingKeyKey = attribute.Key("messaging.gcp_pubsub.message.ordering_key") + + // MessagingKafkaMessageKeyKey is the attribute Key conforming to the + // "messaging.kafka.message.key" semantic conventions. It represents the message + // keys in Kafka are used for grouping alike messages to ensure they're + // processed on the same partition. They differ from `messaging.message.id` in + // that they're not unique. If the key is `null`, the attribute MUST NOT be set. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myKey + // Note: If the key type is not string, it's string representation has to be + // supplied for the attribute. If the key has no unambiguous, canonical string + // form, don't include its value. + MessagingKafkaMessageKeyKey = attribute.Key("messaging.kafka.message.key") + + // MessagingKafkaMessageTombstoneKey is the attribute Key conforming to the + // "messaging.kafka.message.tombstone" semantic conventions. It represents a + // boolean that is true if the message is a tombstone. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingKafkaMessageTombstoneKey = attribute.Key("messaging.kafka.message.tombstone") + + // MessagingKafkaOffsetKey is the attribute Key conforming to the + // "messaging.kafka.offset" semantic conventions. It represents the offset of a + // record in the corresponding Kafka partition. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingKafkaOffsetKey = attribute.Key("messaging.kafka.offset") + + // MessagingMessageBodySizeKey is the attribute Key conforming to the + // "messaging.message.body.size" semantic conventions. It represents the size of + // the message body in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: This can refer to both the compressed or uncompressed body size. If + // both sizes are known, the uncompressed + // body size should be used. + MessagingMessageBodySizeKey = attribute.Key("messaging.message.body.size") + + // MessagingMessageConversationIDKey is the attribute Key conforming to the + // "messaging.message.conversation_id" semantic conventions. It represents the + // conversation ID identifying the conversation to which the message belongs, + // represented as a string. Sometimes called "Correlation ID". + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: MyConversationId + MessagingMessageConversationIDKey = attribute.Key("messaging.message.conversation_id") + + // MessagingMessageEnvelopeSizeKey is the attribute Key conforming to the + // "messaging.message.envelope.size" semantic conventions. It represents the + // size of the message body and metadata in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: This can refer to both the compressed or uncompressed size. If both + // sizes are known, the uncompressed + // size should be used. + MessagingMessageEnvelopeSizeKey = attribute.Key("messaging.message.envelope.size") + + // MessagingMessageIDKey is the attribute Key conforming to the + // "messaging.message.id" semantic conventions. It represents a value used by + // the messaging system as an identifier for the message, represented as a + // string. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 452a7c7c7c7048c2f887f61572b18fc2 + MessagingMessageIDKey = attribute.Key("messaging.message.id") + + // MessagingOperationNameKey is the attribute Key conforming to the + // "messaging.operation.name" semantic conventions. It represents the + // system-specific name of the messaging operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ack", "nack", "send" + MessagingOperationNameKey = attribute.Key("messaging.operation.name") + + // MessagingOperationTypeKey is the attribute Key conforming to the + // "messaging.operation.type" semantic conventions. It represents a string + // identifying the type of the messaging operation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: If a custom value is used, it MUST be of low cardinality. + MessagingOperationTypeKey = attribute.Key("messaging.operation.type") + + // MessagingRabbitMQDestinationRoutingKeyKey is the attribute Key conforming to + // the "messaging.rabbitmq.destination.routing_key" semantic conventions. It + // represents the rabbitMQ message routing key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myKey + MessagingRabbitMQDestinationRoutingKeyKey = attribute.Key("messaging.rabbitmq.destination.routing_key") + + // MessagingRabbitMQMessageDeliveryTagKey is the attribute Key conforming to the + // "messaging.rabbitmq.message.delivery_tag" semantic conventions. It represents + // the rabbitMQ message delivery tag. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRabbitMQMessageDeliveryTagKey = attribute.Key("messaging.rabbitmq.message.delivery_tag") + + // MessagingRocketMQConsumptionModelKey is the attribute Key conforming to the + // "messaging.rocketmq.consumption_model" semantic conventions. It represents + // the model of message consumption. This only applies to consumer spans. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingRocketMQConsumptionModelKey = attribute.Key("messaging.rocketmq.consumption_model") + + // MessagingRocketMQMessageDelayTimeLevelKey is the attribute Key conforming to + // the "messaging.rocketmq.message.delay_time_level" semantic conventions. It + // represents the delay time level for delay message, which determines the + // message delay time. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRocketMQMessageDelayTimeLevelKey = attribute.Key("messaging.rocketmq.message.delay_time_level") + + // MessagingRocketMQMessageDeliveryTimestampKey is the attribute Key conforming + // to the "messaging.rocketmq.message.delivery_timestamp" semantic conventions. + // It represents the timestamp in milliseconds that the delay message is + // expected to be delivered to consumer. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRocketMQMessageDeliveryTimestampKey = attribute.Key("messaging.rocketmq.message.delivery_timestamp") + + // MessagingRocketMQMessageGroupKey is the attribute Key conforming to the + // "messaging.rocketmq.message.group" semantic conventions. It represents the it + // is essential for FIFO message. Messages that belong to the same message group + // are always processed one by one within the same consumer group. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myMessageGroup + MessagingRocketMQMessageGroupKey = attribute.Key("messaging.rocketmq.message.group") + + // MessagingRocketMQMessageKeysKey is the attribute Key conforming to the + // "messaging.rocketmq.message.keys" semantic conventions. It represents the + // key(s) of message, another way to mark message besides message id. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "keyA", "keyB" + MessagingRocketMQMessageKeysKey = attribute.Key("messaging.rocketmq.message.keys") + + // MessagingRocketMQMessageTagKey is the attribute Key conforming to the + // "messaging.rocketmq.message.tag" semantic conventions. It represents the + // secondary classifier of message besides topic. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: tagA + MessagingRocketMQMessageTagKey = attribute.Key("messaging.rocketmq.message.tag") + + // MessagingRocketMQMessageTypeKey is the attribute Key conforming to the + // "messaging.rocketmq.message.type" semantic conventions. It represents the + // type of message. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingRocketMQMessageTypeKey = attribute.Key("messaging.rocketmq.message.type") + + // MessagingRocketMQNamespaceKey is the attribute Key conforming to the + // "messaging.rocketmq.namespace" semantic conventions. It represents the + // namespace of RocketMQ resources, resources in different namespaces are + // individual. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myNamespace + MessagingRocketMQNamespaceKey = attribute.Key("messaging.rocketmq.namespace") + + // MessagingServiceBusDispositionStatusKey is the attribute Key conforming to + // the "messaging.servicebus.disposition_status" semantic conventions. It + // represents the describes the [settlement type]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [settlement type]: https://learn.microsoft.com/azure/service-bus-messaging/message-transfers-locks-settlement#peeklock + MessagingServiceBusDispositionStatusKey = attribute.Key("messaging.servicebus.disposition_status") + + // MessagingServiceBusMessageDeliveryCountKey is the attribute Key conforming to + // the "messaging.servicebus.message.delivery_count" semantic conventions. It + // represents the number of deliveries that have been attempted for this + // message. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingServiceBusMessageDeliveryCountKey = attribute.Key("messaging.servicebus.message.delivery_count") + + // MessagingServiceBusMessageEnqueuedTimeKey is the attribute Key conforming to + // the "messaging.servicebus.message.enqueued_time" semantic conventions. It + // represents the UTC epoch seconds at which the message has been accepted and + // stored in the entity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingServiceBusMessageEnqueuedTimeKey = attribute.Key("messaging.servicebus.message.enqueued_time") + + // MessagingSystemKey is the attribute Key conforming to the "messaging.system" + // semantic conventions. It represents the messaging system as identified by the + // client instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The actual messaging system may differ from the one known by the + // client. For example, when using Kafka client libraries to communicate with + // Azure Event Hubs, the `messaging.system` is set to `kafka` based on the + // instrumentation's best knowledge. + MessagingSystemKey = attribute.Key("messaging.system") +) + +// MessagingBatchMessageCount returns an attribute KeyValue conforming to the +// "messaging.batch.message_count" semantic conventions. It represents the number +// of messages sent, received, or processed in the scope of the batching +// operation. +func MessagingBatchMessageCount(val int) attribute.KeyValue { + return MessagingBatchMessageCountKey.Int(val) +} + +// MessagingClientID returns an attribute KeyValue conforming to the +// "messaging.client.id" semantic conventions. It represents a unique identifier +// for the client that consumes or produces a message. +func MessagingClientID(val string) attribute.KeyValue { + return MessagingClientIDKey.String(val) +} + +// MessagingConsumerGroupName returns an attribute KeyValue conforming to the +// "messaging.consumer.group.name" semantic conventions. It represents the name +// of the consumer group with which a consumer is associated. +func MessagingConsumerGroupName(val string) attribute.KeyValue { + return MessagingConsumerGroupNameKey.String(val) +} + +// MessagingDestinationAnonymous returns an attribute KeyValue conforming to the +// "messaging.destination.anonymous" semantic conventions. It represents a +// boolean that is true if the message destination is anonymous (could be unnamed +// or have auto-generated name). +func MessagingDestinationAnonymous(val bool) attribute.KeyValue { + return MessagingDestinationAnonymousKey.Bool(val) +} + +// MessagingDestinationName returns an attribute KeyValue conforming to the +// "messaging.destination.name" semantic conventions. It represents the message +// destination name. +func MessagingDestinationName(val string) attribute.KeyValue { + return MessagingDestinationNameKey.String(val) +} + +// MessagingDestinationPartitionID returns an attribute KeyValue conforming to +// the "messaging.destination.partition.id" semantic conventions. It represents +// the identifier of the partition messages are sent to or received from, unique +// within the `messaging.destination.name`. +func MessagingDestinationPartitionID(val string) attribute.KeyValue { + return MessagingDestinationPartitionIDKey.String(val) +} + +// MessagingDestinationSubscriptionName returns an attribute KeyValue conforming +// to the "messaging.destination.subscription.name" semantic conventions. It +// represents the name of the destination subscription from which a message is +// consumed. +func MessagingDestinationSubscriptionName(val string) attribute.KeyValue { + return MessagingDestinationSubscriptionNameKey.String(val) +} + +// MessagingDestinationTemplate returns an attribute KeyValue conforming to the +// "messaging.destination.template" semantic conventions. It represents the low +// cardinality representation of the messaging destination name. +func MessagingDestinationTemplate(val string) attribute.KeyValue { + return MessagingDestinationTemplateKey.String(val) +} + +// MessagingDestinationTemporary returns an attribute KeyValue conforming to the +// "messaging.destination.temporary" semantic conventions. It represents a +// boolean that is true if the message destination is temporary and might not +// exist anymore after messages are processed. +func MessagingDestinationTemporary(val bool) attribute.KeyValue { + return MessagingDestinationTemporaryKey.Bool(val) +} + +// MessagingEventHubsMessageEnqueuedTime returns an attribute KeyValue conforming +// to the "messaging.eventhubs.message.enqueued_time" semantic conventions. It +// represents the UTC epoch seconds at which the message has been accepted and +// stored in the entity. +func MessagingEventHubsMessageEnqueuedTime(val int) attribute.KeyValue { + return MessagingEventHubsMessageEnqueuedTimeKey.Int(val) +} + +// MessagingGCPPubSubMessageAckDeadline returns an attribute KeyValue conforming +// to the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It +// represents the ack deadline in seconds set for the modify ack deadline +// request. +func MessagingGCPPubSubMessageAckDeadline(val int) attribute.KeyValue { + return MessagingGCPPubSubMessageAckDeadlineKey.Int(val) +} + +// MessagingGCPPubSubMessageAckID returns an attribute KeyValue conforming to the +// "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the +// ack id for a given message. +func MessagingGCPPubSubMessageAckID(val string) attribute.KeyValue { + return MessagingGCPPubSubMessageAckIDKey.String(val) +} + +// MessagingGCPPubSubMessageDeliveryAttempt returns an attribute KeyValue +// conforming to the "messaging.gcp_pubsub.message.delivery_attempt" semantic +// conventions. It represents the delivery attempt for a given message. +func MessagingGCPPubSubMessageDeliveryAttempt(val int) attribute.KeyValue { + return MessagingGCPPubSubMessageDeliveryAttemptKey.Int(val) +} + +// MessagingGCPPubSubMessageOrderingKey returns an attribute KeyValue conforming +// to the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It +// represents the ordering key for a given message. If the attribute is not +// present, the message does not have an ordering key. +func MessagingGCPPubSubMessageOrderingKey(val string) attribute.KeyValue { + return MessagingGCPPubSubMessageOrderingKeyKey.String(val) +} + +// MessagingKafkaMessageKey returns an attribute KeyValue conforming to the +// "messaging.kafka.message.key" semantic conventions. It represents the message +// keys in Kafka are used for grouping alike messages to ensure they're processed +// on the same partition. They differ from `messaging.message.id` in that they're +// not unique. If the key is `null`, the attribute MUST NOT be set. +func MessagingKafkaMessageKey(val string) attribute.KeyValue { + return MessagingKafkaMessageKeyKey.String(val) +} + +// MessagingKafkaMessageTombstone returns an attribute KeyValue conforming to the +// "messaging.kafka.message.tombstone" semantic conventions. It represents a +// boolean that is true if the message is a tombstone. +func MessagingKafkaMessageTombstone(val bool) attribute.KeyValue { + return MessagingKafkaMessageTombstoneKey.Bool(val) +} + +// MessagingKafkaOffset returns an attribute KeyValue conforming to the +// "messaging.kafka.offset" semantic conventions. It represents the offset of a +// record in the corresponding Kafka partition. +func MessagingKafkaOffset(val int) attribute.KeyValue { + return MessagingKafkaOffsetKey.Int(val) +} + +// MessagingMessageBodySize returns an attribute KeyValue conforming to the +// "messaging.message.body.size" semantic conventions. It represents the size of +// the message body in bytes. +func MessagingMessageBodySize(val int) attribute.KeyValue { + return MessagingMessageBodySizeKey.Int(val) +} + +// MessagingMessageConversationID returns an attribute KeyValue conforming to the +// "messaging.message.conversation_id" semantic conventions. It represents the +// conversation ID identifying the conversation to which the message belongs, +// represented as a string. Sometimes called "Correlation ID". +func MessagingMessageConversationID(val string) attribute.KeyValue { + return MessagingMessageConversationIDKey.String(val) +} + +// MessagingMessageEnvelopeSize returns an attribute KeyValue conforming to the +// "messaging.message.envelope.size" semantic conventions. It represents the size +// of the message body and metadata in bytes. +func MessagingMessageEnvelopeSize(val int) attribute.KeyValue { + return MessagingMessageEnvelopeSizeKey.Int(val) +} + +// MessagingMessageID returns an attribute KeyValue conforming to the +// "messaging.message.id" semantic conventions. It represents a value used by the +// messaging system as an identifier for the message, represented as a string. +func MessagingMessageID(val string) attribute.KeyValue { + return MessagingMessageIDKey.String(val) +} + +// MessagingOperationName returns an attribute KeyValue conforming to the +// "messaging.operation.name" semantic conventions. It represents the +// system-specific name of the messaging operation. +func MessagingOperationName(val string) attribute.KeyValue { + return MessagingOperationNameKey.String(val) +} + +// MessagingRabbitMQDestinationRoutingKey returns an attribute KeyValue +// conforming to the "messaging.rabbitmq.destination.routing_key" semantic +// conventions. It represents the rabbitMQ message routing key. +func MessagingRabbitMQDestinationRoutingKey(val string) attribute.KeyValue { + return MessagingRabbitMQDestinationRoutingKeyKey.String(val) +} + +// MessagingRabbitMQMessageDeliveryTag returns an attribute KeyValue conforming +// to the "messaging.rabbitmq.message.delivery_tag" semantic conventions. It +// represents the rabbitMQ message delivery tag. +func MessagingRabbitMQMessageDeliveryTag(val int) attribute.KeyValue { + return MessagingRabbitMQMessageDeliveryTagKey.Int(val) +} + +// MessagingRocketMQMessageDelayTimeLevel returns an attribute KeyValue +// conforming to the "messaging.rocketmq.message.delay_time_level" semantic +// conventions. It represents the delay time level for delay message, which +// determines the message delay time. +func MessagingRocketMQMessageDelayTimeLevel(val int) attribute.KeyValue { + return MessagingRocketMQMessageDelayTimeLevelKey.Int(val) +} + +// MessagingRocketMQMessageDeliveryTimestamp returns an attribute KeyValue +// conforming to the "messaging.rocketmq.message.delivery_timestamp" semantic +// conventions. It represents the timestamp in milliseconds that the delay +// message is expected to be delivered to consumer. +func MessagingRocketMQMessageDeliveryTimestamp(val int) attribute.KeyValue { + return MessagingRocketMQMessageDeliveryTimestampKey.Int(val) +} + +// MessagingRocketMQMessageGroup returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.group" semantic conventions. It represents the it +// is essential for FIFO message. Messages that belong to the same message group +// are always processed one by one within the same consumer group. +func MessagingRocketMQMessageGroup(val string) attribute.KeyValue { + return MessagingRocketMQMessageGroupKey.String(val) +} + +// MessagingRocketMQMessageKeys returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.keys" semantic conventions. It represents the +// key(s) of message, another way to mark message besides message id. +func MessagingRocketMQMessageKeys(val ...string) attribute.KeyValue { + return MessagingRocketMQMessageKeysKey.StringSlice(val) +} + +// MessagingRocketMQMessageTag returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.tag" semantic conventions. It represents the +// secondary classifier of message besides topic. +func MessagingRocketMQMessageTag(val string) attribute.KeyValue { + return MessagingRocketMQMessageTagKey.String(val) +} + +// MessagingRocketMQNamespace returns an attribute KeyValue conforming to the +// "messaging.rocketmq.namespace" semantic conventions. It represents the +// namespace of RocketMQ resources, resources in different namespaces are +// individual. +func MessagingRocketMQNamespace(val string) attribute.KeyValue { + return MessagingRocketMQNamespaceKey.String(val) +} + +// MessagingServiceBusMessageDeliveryCount returns an attribute KeyValue +// conforming to the "messaging.servicebus.message.delivery_count" semantic +// conventions. It represents the number of deliveries that have been attempted +// for this message. +func MessagingServiceBusMessageDeliveryCount(val int) attribute.KeyValue { + return MessagingServiceBusMessageDeliveryCountKey.Int(val) +} + +// MessagingServiceBusMessageEnqueuedTime returns an attribute KeyValue +// conforming to the "messaging.servicebus.message.enqueued_time" semantic +// conventions. It represents the UTC epoch seconds at which the message has been +// accepted and stored in the entity. +func MessagingServiceBusMessageEnqueuedTime(val int) attribute.KeyValue { + return MessagingServiceBusMessageEnqueuedTimeKey.Int(val) +} + +// Enum values for messaging.operation.type +var ( + // A message is created. "Create" spans always refer to a single message and are + // used to provide a unique creation context for messages in batch sending + // scenarios. + // + // Stability: development + MessagingOperationTypeCreate = MessagingOperationTypeKey.String("create") + // One or more messages are provided for sending to an intermediary. If a single + // message is sent, the context of the "Send" span can be used as the creation + // context and no "Create" span needs to be created. + // + // Stability: development + MessagingOperationTypeSend = MessagingOperationTypeKey.String("send") + // One or more messages are requested by a consumer. This operation refers to + // pull-based scenarios, where consumers explicitly call methods of messaging + // SDKs to receive messages. + // + // Stability: development + MessagingOperationTypeReceive = MessagingOperationTypeKey.String("receive") + // One or more messages are processed by a consumer. + // + // Stability: development + MessagingOperationTypeProcess = MessagingOperationTypeKey.String("process") + // One or more messages are settled. + // + // Stability: development + MessagingOperationTypeSettle = MessagingOperationTypeKey.String("settle") + // Deprecated: Replaced by `process`. + MessagingOperationTypeDeliver = MessagingOperationTypeKey.String("deliver") + // Deprecated: Replaced by `send`. + MessagingOperationTypePublish = MessagingOperationTypeKey.String("publish") +) + +// Enum values for messaging.rocketmq.consumption_model +var ( + // Clustering consumption model + // Stability: development + MessagingRocketMQConsumptionModelClustering = MessagingRocketMQConsumptionModelKey.String("clustering") + // Broadcasting consumption model + // Stability: development + MessagingRocketMQConsumptionModelBroadcasting = MessagingRocketMQConsumptionModelKey.String("broadcasting") +) + +// Enum values for messaging.rocketmq.message.type +var ( + // Normal message + // Stability: development + MessagingRocketMQMessageTypeNormal = MessagingRocketMQMessageTypeKey.String("normal") + // FIFO message + // Stability: development + MessagingRocketMQMessageTypeFifo = MessagingRocketMQMessageTypeKey.String("fifo") + // Delay message + // Stability: development + MessagingRocketMQMessageTypeDelay = MessagingRocketMQMessageTypeKey.String("delay") + // Transaction message + // Stability: development + MessagingRocketMQMessageTypeTransaction = MessagingRocketMQMessageTypeKey.String("transaction") +) + +// Enum values for messaging.servicebus.disposition_status +var ( + // Message is completed + // Stability: development + MessagingServiceBusDispositionStatusComplete = MessagingServiceBusDispositionStatusKey.String("complete") + // Message is abandoned + // Stability: development + MessagingServiceBusDispositionStatusAbandon = MessagingServiceBusDispositionStatusKey.String("abandon") + // Message is sent to dead letter queue + // Stability: development + MessagingServiceBusDispositionStatusDeadLetter = MessagingServiceBusDispositionStatusKey.String("dead_letter") + // Message is deferred + // Stability: development + MessagingServiceBusDispositionStatusDefer = MessagingServiceBusDispositionStatusKey.String("defer") +) + +// Enum values for messaging.system +var ( + // Apache ActiveMQ + // Stability: development + MessagingSystemActiveMQ = MessagingSystemKey.String("activemq") + // Amazon Simple Queue Service (SQS) + // Stability: development + MessagingSystemAWSSQS = MessagingSystemKey.String("aws_sqs") + // Azure Event Grid + // Stability: development + MessagingSystemEventGrid = MessagingSystemKey.String("eventgrid") + // Azure Event Hubs + // Stability: development + MessagingSystemEventHubs = MessagingSystemKey.String("eventhubs") + // Azure Service Bus + // Stability: development + MessagingSystemServiceBus = MessagingSystemKey.String("servicebus") + // Google Cloud Pub/Sub + // Stability: development + MessagingSystemGCPPubSub = MessagingSystemKey.String("gcp_pubsub") + // Java Message Service + // Stability: development + MessagingSystemJMS = MessagingSystemKey.String("jms") + // Apache Kafka + // Stability: development + MessagingSystemKafka = MessagingSystemKey.String("kafka") + // RabbitMQ + // Stability: development + MessagingSystemRabbitMQ = MessagingSystemKey.String("rabbitmq") + // Apache RocketMQ + // Stability: development + MessagingSystemRocketMQ = MessagingSystemKey.String("rocketmq") + // Apache Pulsar + // Stability: development + MessagingSystemPulsar = MessagingSystemKey.String("pulsar") +) + +// Namespace: network +const ( + // NetworkCarrierICCKey is the attribute Key conforming to the + // "network.carrier.icc" semantic conventions. It represents the ISO 3166-1 + // alpha-2 2-character country code associated with the mobile carrier network. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: DE + NetworkCarrierICCKey = attribute.Key("network.carrier.icc") + + // NetworkCarrierMCCKey is the attribute Key conforming to the + // "network.carrier.mcc" semantic conventions. It represents the mobile carrier + // country code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 310 + NetworkCarrierMCCKey = attribute.Key("network.carrier.mcc") + + // NetworkCarrierMNCKey is the attribute Key conforming to the + // "network.carrier.mnc" semantic conventions. It represents the mobile carrier + // network code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 001 + NetworkCarrierMNCKey = attribute.Key("network.carrier.mnc") + + // NetworkCarrierNameKey is the attribute Key conforming to the + // "network.carrier.name" semantic conventions. It represents the name of the + // mobile carrier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: sprint + NetworkCarrierNameKey = attribute.Key("network.carrier.name") + + // NetworkConnectionStateKey is the attribute Key conforming to the + // "network.connection.state" semantic conventions. It represents the state of + // network connection. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "close_wait" + // Note: Connection states are defined as part of the [rfc9293] + // + // [rfc9293]: https://datatracker.ietf.org/doc/html/rfc9293#section-3.3.2 + NetworkConnectionStateKey = attribute.Key("network.connection.state") + + // NetworkConnectionSubtypeKey is the attribute Key conforming to the + // "network.connection.subtype" semantic conventions. It represents the this + // describes more details regarding the connection.type. It may be the type of + // cell technology connection, but it could be used for describing details about + // a wifi connection. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: LTE + NetworkConnectionSubtypeKey = attribute.Key("network.connection.subtype") + + // NetworkConnectionTypeKey is the attribute Key conforming to the + // "network.connection.type" semantic conventions. It represents the internet + // connection type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: wifi + NetworkConnectionTypeKey = attribute.Key("network.connection.type") + + // NetworkInterfaceNameKey is the attribute Key conforming to the + // "network.interface.name" semantic conventions. It represents the network + // interface name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "lo", "eth0" + NetworkInterfaceNameKey = attribute.Key("network.interface.name") + + // NetworkIODirectionKey is the attribute Key conforming to the + // "network.io.direction" semantic conventions. It represents the network IO + // operation direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "transmit" + NetworkIODirectionKey = attribute.Key("network.io.direction") + + // NetworkLocalAddressKey is the attribute Key conforming to the + // "network.local.address" semantic conventions. It represents the local address + // of the network connection - IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "10.1.2.80", "/tmp/my.sock" + NetworkLocalAddressKey = attribute.Key("network.local.address") + + // NetworkLocalPortKey is the attribute Key conforming to the + // "network.local.port" semantic conventions. It represents the local port + // number of the network connection. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + NetworkLocalPortKey = attribute.Key("network.local.port") + + // NetworkPeerAddressKey is the attribute Key conforming to the + // "network.peer.address" semantic conventions. It represents the peer address + // of the network connection - IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "10.1.2.80", "/tmp/my.sock" + NetworkPeerAddressKey = attribute.Key("network.peer.address") + + // NetworkPeerPortKey is the attribute Key conforming to the "network.peer.port" + // semantic conventions. It represents the peer port number of the network + // connection. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + NetworkPeerPortKey = attribute.Key("network.peer.port") + + // NetworkProtocolNameKey is the attribute Key conforming to the + // "network.protocol.name" semantic conventions. It represents the + // [OSI application layer] or non-OSI equivalent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "amqp", "http", "mqtt" + // Note: The value SHOULD be normalized to lowercase. + // + // [OSI application layer]: https://wikipedia.org/wiki/Application_layer + NetworkProtocolNameKey = attribute.Key("network.protocol.name") + + // NetworkProtocolVersionKey is the attribute Key conforming to the + // "network.protocol.version" semantic conventions. It represents the actual + // version of the protocol used for network communication. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.1", "2" + // Note: If protocol version is subject to negotiation (for example using [ALPN] + // ), this attribute SHOULD be set to the negotiated version. If the actual + // protocol version is not known, this attribute SHOULD NOT be set. + // + // [ALPN]: https://www.rfc-editor.org/rfc/rfc7301.html + NetworkProtocolVersionKey = attribute.Key("network.protocol.version") + + // NetworkTransportKey is the attribute Key conforming to the + // "network.transport" semantic conventions. It represents the + // [OSI transport layer] or [inter-process communication method]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "tcp", "udp" + // Note: The value SHOULD be normalized to lowercase. + // + // Consider always setting the transport when setting a port number, since + // a port number is ambiguous without knowing the transport. For example + // different processes could be listening on TCP port 12345 and UDP port 12345. + // + // [OSI transport layer]: https://wikipedia.org/wiki/Transport_layer + // [inter-process communication method]: https://wikipedia.org/wiki/Inter-process_communication + NetworkTransportKey = attribute.Key("network.transport") + + // NetworkTypeKey is the attribute Key conforming to the "network.type" semantic + // conventions. It represents the [OSI network layer] or non-OSI equivalent. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "ipv4", "ipv6" + // Note: The value SHOULD be normalized to lowercase. + // + // [OSI network layer]: https://wikipedia.org/wiki/Network_layer + NetworkTypeKey = attribute.Key("network.type") +) + +// NetworkCarrierICC returns an attribute KeyValue conforming to the +// "network.carrier.icc" semantic conventions. It represents the ISO 3166-1 +// alpha-2 2-character country code associated with the mobile carrier network. +func NetworkCarrierICC(val string) attribute.KeyValue { + return NetworkCarrierICCKey.String(val) +} + +// NetworkCarrierMCC returns an attribute KeyValue conforming to the +// "network.carrier.mcc" semantic conventions. It represents the mobile carrier +// country code. +func NetworkCarrierMCC(val string) attribute.KeyValue { + return NetworkCarrierMCCKey.String(val) +} + +// NetworkCarrierMNC returns an attribute KeyValue conforming to the +// "network.carrier.mnc" semantic conventions. It represents the mobile carrier +// network code. +func NetworkCarrierMNC(val string) attribute.KeyValue { + return NetworkCarrierMNCKey.String(val) +} + +// NetworkCarrierName returns an attribute KeyValue conforming to the +// "network.carrier.name" semantic conventions. It represents the name of the +// mobile carrier. +func NetworkCarrierName(val string) attribute.KeyValue { + return NetworkCarrierNameKey.String(val) +} + +// NetworkInterfaceName returns an attribute KeyValue conforming to the +// "network.interface.name" semantic conventions. It represents the network +// interface name. +func NetworkInterfaceName(val string) attribute.KeyValue { + return NetworkInterfaceNameKey.String(val) +} + +// NetworkLocalAddress returns an attribute KeyValue conforming to the +// "network.local.address" semantic conventions. It represents the local address +// of the network connection - IP address or Unix domain socket name. +func NetworkLocalAddress(val string) attribute.KeyValue { + return NetworkLocalAddressKey.String(val) +} + +// NetworkLocalPort returns an attribute KeyValue conforming to the +// "network.local.port" semantic conventions. It represents the local port number +// of the network connection. +func NetworkLocalPort(val int) attribute.KeyValue { + return NetworkLocalPortKey.Int(val) +} + +// NetworkPeerAddress returns an attribute KeyValue conforming to the +// "network.peer.address" semantic conventions. It represents the peer address of +// the network connection - IP address or Unix domain socket name. +func NetworkPeerAddress(val string) attribute.KeyValue { + return NetworkPeerAddressKey.String(val) +} + +// NetworkPeerPort returns an attribute KeyValue conforming to the +// "network.peer.port" semantic conventions. It represents the peer port number +// of the network connection. +func NetworkPeerPort(val int) attribute.KeyValue { + return NetworkPeerPortKey.Int(val) +} + +// NetworkProtocolName returns an attribute KeyValue conforming to the +// "network.protocol.name" semantic conventions. It represents the +// [OSI application layer] or non-OSI equivalent. +// +// [OSI application layer]: https://wikipedia.org/wiki/Application_layer +func NetworkProtocolName(val string) attribute.KeyValue { + return NetworkProtocolNameKey.String(val) +} + +// NetworkProtocolVersion returns an attribute KeyValue conforming to the +// "network.protocol.version" semantic conventions. It represents the actual +// version of the protocol used for network communication. +func NetworkProtocolVersion(val string) attribute.KeyValue { + return NetworkProtocolVersionKey.String(val) +} + +// Enum values for network.connection.state +var ( + // closed + // Stability: development + NetworkConnectionStateClosed = NetworkConnectionStateKey.String("closed") + // close_wait + // Stability: development + NetworkConnectionStateCloseWait = NetworkConnectionStateKey.String("close_wait") + // closing + // Stability: development + NetworkConnectionStateClosing = NetworkConnectionStateKey.String("closing") + // established + // Stability: development + NetworkConnectionStateEstablished = NetworkConnectionStateKey.String("established") + // fin_wait_1 + // Stability: development + NetworkConnectionStateFinWait1 = NetworkConnectionStateKey.String("fin_wait_1") + // fin_wait_2 + // Stability: development + NetworkConnectionStateFinWait2 = NetworkConnectionStateKey.String("fin_wait_2") + // last_ack + // Stability: development + NetworkConnectionStateLastAck = NetworkConnectionStateKey.String("last_ack") + // listen + // Stability: development + NetworkConnectionStateListen = NetworkConnectionStateKey.String("listen") + // syn_received + // Stability: development + NetworkConnectionStateSynReceived = NetworkConnectionStateKey.String("syn_received") + // syn_sent + // Stability: development + NetworkConnectionStateSynSent = NetworkConnectionStateKey.String("syn_sent") + // time_wait + // Stability: development + NetworkConnectionStateTimeWait = NetworkConnectionStateKey.String("time_wait") +) + +// Enum values for network.connection.subtype +var ( + // GPRS + // Stability: development + NetworkConnectionSubtypeGprs = NetworkConnectionSubtypeKey.String("gprs") + // EDGE + // Stability: development + NetworkConnectionSubtypeEdge = NetworkConnectionSubtypeKey.String("edge") + // UMTS + // Stability: development + NetworkConnectionSubtypeUmts = NetworkConnectionSubtypeKey.String("umts") + // CDMA + // Stability: development + NetworkConnectionSubtypeCdma = NetworkConnectionSubtypeKey.String("cdma") + // EVDO Rel. 0 + // Stability: development + NetworkConnectionSubtypeEvdo0 = NetworkConnectionSubtypeKey.String("evdo_0") + // EVDO Rev. A + // Stability: development + NetworkConnectionSubtypeEvdoA = NetworkConnectionSubtypeKey.String("evdo_a") + // CDMA2000 1XRTT + // Stability: development + NetworkConnectionSubtypeCdma20001xrtt = NetworkConnectionSubtypeKey.String("cdma2000_1xrtt") + // HSDPA + // Stability: development + NetworkConnectionSubtypeHsdpa = NetworkConnectionSubtypeKey.String("hsdpa") + // HSUPA + // Stability: development + NetworkConnectionSubtypeHsupa = NetworkConnectionSubtypeKey.String("hsupa") + // HSPA + // Stability: development + NetworkConnectionSubtypeHspa = NetworkConnectionSubtypeKey.String("hspa") + // IDEN + // Stability: development + NetworkConnectionSubtypeIden = NetworkConnectionSubtypeKey.String("iden") + // EVDO Rev. B + // Stability: development + NetworkConnectionSubtypeEvdoB = NetworkConnectionSubtypeKey.String("evdo_b") + // LTE + // Stability: development + NetworkConnectionSubtypeLte = NetworkConnectionSubtypeKey.String("lte") + // EHRPD + // Stability: development + NetworkConnectionSubtypeEhrpd = NetworkConnectionSubtypeKey.String("ehrpd") + // HSPAP + // Stability: development + NetworkConnectionSubtypeHspap = NetworkConnectionSubtypeKey.String("hspap") + // GSM + // Stability: development + NetworkConnectionSubtypeGsm = NetworkConnectionSubtypeKey.String("gsm") + // TD-SCDMA + // Stability: development + NetworkConnectionSubtypeTdScdma = NetworkConnectionSubtypeKey.String("td_scdma") + // IWLAN + // Stability: development + NetworkConnectionSubtypeIwlan = NetworkConnectionSubtypeKey.String("iwlan") + // 5G NR (New Radio) + // Stability: development + NetworkConnectionSubtypeNr = NetworkConnectionSubtypeKey.String("nr") + // 5G NRNSA (New Radio Non-Standalone) + // Stability: development + NetworkConnectionSubtypeNrnsa = NetworkConnectionSubtypeKey.String("nrnsa") + // LTE CA + // Stability: development + NetworkConnectionSubtypeLteCa = NetworkConnectionSubtypeKey.String("lte_ca") +) + +// Enum values for network.connection.type +var ( + // wifi + // Stability: development + NetworkConnectionTypeWifi = NetworkConnectionTypeKey.String("wifi") + // wired + // Stability: development + NetworkConnectionTypeWired = NetworkConnectionTypeKey.String("wired") + // cell + // Stability: development + NetworkConnectionTypeCell = NetworkConnectionTypeKey.String("cell") + // unavailable + // Stability: development + NetworkConnectionTypeUnavailable = NetworkConnectionTypeKey.String("unavailable") + // unknown + // Stability: development + NetworkConnectionTypeUnknown = NetworkConnectionTypeKey.String("unknown") +) + +// Enum values for network.io.direction +var ( + // transmit + // Stability: development + NetworkIODirectionTransmit = NetworkIODirectionKey.String("transmit") + // receive + // Stability: development + NetworkIODirectionReceive = NetworkIODirectionKey.String("receive") +) + +// Enum values for network.transport +var ( + // TCP + // Stability: stable + NetworkTransportTCP = NetworkTransportKey.String("tcp") + // UDP + // Stability: stable + NetworkTransportUDP = NetworkTransportKey.String("udp") + // Named or anonymous pipe. + // Stability: stable + NetworkTransportPipe = NetworkTransportKey.String("pipe") + // Unix domain socket + // Stability: stable + NetworkTransportUnix = NetworkTransportKey.String("unix") + // QUIC + // Stability: stable + NetworkTransportQUIC = NetworkTransportKey.String("quic") +) + +// Enum values for network.type +var ( + // IPv4 + // Stability: stable + NetworkTypeIPv4 = NetworkTypeKey.String("ipv4") + // IPv6 + // Stability: stable + NetworkTypeIPv6 = NetworkTypeKey.String("ipv6") +) + +// Namespace: oci +const ( + // OCIManifestDigestKey is the attribute Key conforming to the + // "oci.manifest.digest" semantic conventions. It represents the digest of the + // OCI image manifest. For container images specifically is the digest by which + // the container image is known. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "sha256:e4ca62c0d62f3e886e684806dfe9d4e0cda60d54986898173c1083856cfda0f4" + // Note: Follows [OCI Image Manifest Specification], and specifically the + // [Digest property]. + // An example can be found in [Example Image Manifest]. + // + // [OCI Image Manifest Specification]: https://github.com/opencontainers/image-spec/blob/main/manifest.md + // [Digest property]: https://github.com/opencontainers/image-spec/blob/main/descriptor.md#digests + // [Example Image Manifest]: https://github.com/opencontainers/image-spec/blob/main/manifest.md#example-image-manifest + OCIManifestDigestKey = attribute.Key("oci.manifest.digest") +) + +// OCIManifestDigest returns an attribute KeyValue conforming to the +// "oci.manifest.digest" semantic conventions. It represents the digest of the +// OCI image manifest. For container images specifically is the digest by which +// the container image is known. +func OCIManifestDigest(val string) attribute.KeyValue { + return OCIManifestDigestKey.String(val) +} + +// Namespace: opentracing +const ( + // OpenTracingRefTypeKey is the attribute Key conforming to the + // "opentracing.ref_type" semantic conventions. It represents the parent-child + // Reference type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The causal relationship between a child Span and a parent Span. + OpenTracingRefTypeKey = attribute.Key("opentracing.ref_type") +) + +// Enum values for opentracing.ref_type +var ( + // The parent Span depends on the child Span in some capacity + // Stability: development + OpenTracingRefTypeChildOf = OpenTracingRefTypeKey.String("child_of") + // The parent Span doesn't depend in any way on the result of the child Span + // Stability: development + OpenTracingRefTypeFollowsFrom = OpenTracingRefTypeKey.String("follows_from") +) + +// Namespace: os +const ( + // OSBuildIDKey is the attribute Key conforming to the "os.build_id" semantic + // conventions. It represents the unique identifier for a particular build or + // compilation of the operating system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TQ3C.230805.001.B2", "20E247", "22621" + OSBuildIDKey = attribute.Key("os.build_id") + + // OSDescriptionKey is the attribute Key conforming to the "os.description" + // semantic conventions. It represents the human readable (not intended to be + // parsed) OS version information, like e.g. reported by `ver` or + // `lsb_release -a` commands. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Microsoft Windows [Version 10.0.18363.778]", "Ubuntu 18.04.1 LTS" + OSDescriptionKey = attribute.Key("os.description") + + // OSNameKey is the attribute Key conforming to the "os.name" semantic + // conventions. It represents the human readable operating system name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iOS", "Android", "Ubuntu" + OSNameKey = attribute.Key("os.name") + + // OSTypeKey is the attribute Key conforming to the "os.type" semantic + // conventions. It represents the operating system type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + OSTypeKey = attribute.Key("os.type") + + // OSVersionKey is the attribute Key conforming to the "os.version" semantic + // conventions. It represents the version string of the operating system as + // defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.2.1", "18.04.1" + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + OSVersionKey = attribute.Key("os.version") +) + +// OSBuildID returns an attribute KeyValue conforming to the "os.build_id" +// semantic conventions. It represents the unique identifier for a particular +// build or compilation of the operating system. +func OSBuildID(val string) attribute.KeyValue { + return OSBuildIDKey.String(val) +} + +// OSDescription returns an attribute KeyValue conforming to the "os.description" +// semantic conventions. It represents the human readable (not intended to be +// parsed) OS version information, like e.g. reported by `ver` or +// `lsb_release -a` commands. +func OSDescription(val string) attribute.KeyValue { + return OSDescriptionKey.String(val) +} + +// OSName returns an attribute KeyValue conforming to the "os.name" semantic +// conventions. It represents the human readable operating system name. +func OSName(val string) attribute.KeyValue { + return OSNameKey.String(val) +} + +// OSVersion returns an attribute KeyValue conforming to the "os.version" +// semantic conventions. It represents the version string of the operating system +// as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func OSVersion(val string) attribute.KeyValue { + return OSVersionKey.String(val) +} + +// Enum values for os.type +var ( + // Microsoft Windows + // Stability: development + OSTypeWindows = OSTypeKey.String("windows") + // Linux + // Stability: development + OSTypeLinux = OSTypeKey.String("linux") + // Apple Darwin + // Stability: development + OSTypeDarwin = OSTypeKey.String("darwin") + // FreeBSD + // Stability: development + OSTypeFreeBSD = OSTypeKey.String("freebsd") + // NetBSD + // Stability: development + OSTypeNetBSD = OSTypeKey.String("netbsd") + // OpenBSD + // Stability: development + OSTypeOpenBSD = OSTypeKey.String("openbsd") + // DragonFly BSD + // Stability: development + OSTypeDragonflyBSD = OSTypeKey.String("dragonflybsd") + // HP-UX (Hewlett Packard Unix) + // Stability: development + OSTypeHPUX = OSTypeKey.String("hpux") + // AIX (Advanced Interactive eXecutive) + // Stability: development + OSTypeAIX = OSTypeKey.String("aix") + // SunOS, Oracle Solaris + // Stability: development + OSTypeSolaris = OSTypeKey.String("solaris") + // IBM z/OS + // Stability: development + OSTypeZOS = OSTypeKey.String("z_os") +) + +// Namespace: otel +const ( + // OTelComponentNameKey is the attribute Key conforming to the + // "otel.component.name" semantic conventions. It represents a name uniquely + // identifying the instance of the OpenTelemetry component within its containing + // SDK instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otlp_grpc_span_exporter/0", "custom-name" + // Note: Implementations SHOULD ensure a low cardinality for this attribute, + // even across application or SDK restarts. + // E.g. implementations MUST NOT use UUIDs as values for this attribute. + // + // Implementations MAY achieve these goals by following a + // `/` pattern, e.g. + // `batching_span_processor/0`. + // Hereby `otel.component.type` refers to the corresponding attribute value of + // the component. + // + // The value of `instance-counter` MAY be automatically assigned by the + // component and uniqueness within the enclosing SDK instance MUST be + // guaranteed. + // For example, `` MAY be implemented by using a monotonically + // increasing counter (starting with `0`), which is incremented every time an + // instance of the given component type is started. + // + // With this implementation, for example the first Batching Span Processor would + // have `batching_span_processor/0` + // as `otel.component.name`, the second one `batching_span_processor/1` and so + // on. + // These values will therefore be reused in the case of an application restart. + OTelComponentNameKey = attribute.Key("otel.component.name") + + // OTelComponentTypeKey is the attribute Key conforming to the + // "otel.component.type" semantic conventions. It represents a name identifying + // the type of the OpenTelemetry component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "batching_span_processor", "com.example.MySpanExporter" + // Note: If none of the standardized values apply, implementations SHOULD use + // the language-defined name of the type. + // E.g. for Java the fully qualified classname SHOULD be used in this case. + OTelComponentTypeKey = attribute.Key("otel.component.type") + + // OTelScopeNameKey is the attribute Key conforming to the "otel.scope.name" + // semantic conventions. It represents the name of the instrumentation scope - ( + // `InstrumentationScope.Name` in OTLP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "io.opentelemetry.contrib.mongodb" + OTelScopeNameKey = attribute.Key("otel.scope.name") + + // OTelScopeVersionKey is the attribute Key conforming to the + // "otel.scope.version" semantic conventions. It represents the version of the + // instrumentation scope - (`InstrumentationScope.Version` in OTLP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.0.0" + OTelScopeVersionKey = attribute.Key("otel.scope.version") + + // OTelSpanSamplingResultKey is the attribute Key conforming to the + // "otel.span.sampling_result" semantic conventions. It represents the result + // value of the sampler for this span. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + OTelSpanSamplingResultKey = attribute.Key("otel.span.sampling_result") + + // OTelStatusCodeKey is the attribute Key conforming to the "otel.status_code" + // semantic conventions. It represents the name of the code, either "OK" or + // "ERROR". MUST NOT be set if the status code is UNSET. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + OTelStatusCodeKey = attribute.Key("otel.status_code") + + // OTelStatusDescriptionKey is the attribute Key conforming to the + // "otel.status_description" semantic conventions. It represents the description + // of the Status if it has a value, otherwise not set. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "resource not found" + OTelStatusDescriptionKey = attribute.Key("otel.status_description") +) + +// OTelComponentName returns an attribute KeyValue conforming to the +// "otel.component.name" semantic conventions. It represents a name uniquely +// identifying the instance of the OpenTelemetry component within its containing +// SDK instance. +func OTelComponentName(val string) attribute.KeyValue { + return OTelComponentNameKey.String(val) +} + +// OTelScopeName returns an attribute KeyValue conforming to the +// "otel.scope.name" semantic conventions. It represents the name of the +// instrumentation scope - (`InstrumentationScope.Name` in OTLP). +func OTelScopeName(val string) attribute.KeyValue { + return OTelScopeNameKey.String(val) +} + +// OTelScopeVersion returns an attribute KeyValue conforming to the +// "otel.scope.version" semantic conventions. It represents the version of the +// instrumentation scope - (`InstrumentationScope.Version` in OTLP). +func OTelScopeVersion(val string) attribute.KeyValue { + return OTelScopeVersionKey.String(val) +} + +// OTelStatusDescription returns an attribute KeyValue conforming to the +// "otel.status_description" semantic conventions. It represents the description +// of the Status if it has a value, otherwise not set. +func OTelStatusDescription(val string) attribute.KeyValue { + return OTelStatusDescriptionKey.String(val) +} + +// Enum values for otel.component.type +var ( + // The builtin SDK batching span processor + // + // Stability: development + OTelComponentTypeBatchingSpanProcessor = OTelComponentTypeKey.String("batching_span_processor") + // The builtin SDK simple span processor + // + // Stability: development + OTelComponentTypeSimpleSpanProcessor = OTelComponentTypeKey.String("simple_span_processor") + // The builtin SDK batching log record processor + // + // Stability: development + OTelComponentTypeBatchingLogProcessor = OTelComponentTypeKey.String("batching_log_processor") + // The builtin SDK simple log record processor + // + // Stability: development + OTelComponentTypeSimpleLogProcessor = OTelComponentTypeKey.String("simple_log_processor") + // OTLP span exporter over gRPC with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpGRPCSpanExporter = OTelComponentTypeKey.String("otlp_grpc_span_exporter") + // OTLP span exporter over HTTP with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPSpanExporter = OTelComponentTypeKey.String("otlp_http_span_exporter") + // OTLP span exporter over HTTP with JSON serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPJSONSpanExporter = OTelComponentTypeKey.String("otlp_http_json_span_exporter") + // OTLP log record exporter over gRPC with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpGRPCLogExporter = OTelComponentTypeKey.String("otlp_grpc_log_exporter") + // OTLP log record exporter over HTTP with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPLogExporter = OTelComponentTypeKey.String("otlp_http_log_exporter") + // OTLP log record exporter over HTTP with JSON serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPJSONLogExporter = OTelComponentTypeKey.String("otlp_http_json_log_exporter") + // The builtin SDK periodically exporting metric reader + // + // Stability: development + OTelComponentTypePeriodicMetricReader = OTelComponentTypeKey.String("periodic_metric_reader") + // OTLP metric exporter over gRPC with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpGRPCMetricExporter = OTelComponentTypeKey.String("otlp_grpc_metric_exporter") + // OTLP metric exporter over HTTP with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPMetricExporter = OTelComponentTypeKey.String("otlp_http_metric_exporter") + // OTLP metric exporter over HTTP with JSON serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPJSONMetricExporter = OTelComponentTypeKey.String("otlp_http_json_metric_exporter") +) + +// Enum values for otel.span.sampling_result +var ( + // The span is not sampled and not recording + // Stability: development + OTelSpanSamplingResultDrop = OTelSpanSamplingResultKey.String("DROP") + // The span is not sampled, but recording + // Stability: development + OTelSpanSamplingResultRecordOnly = OTelSpanSamplingResultKey.String("RECORD_ONLY") + // The span is sampled and recording + // Stability: development + OTelSpanSamplingResultRecordAndSample = OTelSpanSamplingResultKey.String("RECORD_AND_SAMPLE") +) + +// Enum values for otel.status_code +var ( + // The operation has been validated by an Application developer or Operator to + // have completed successfully. + // Stability: stable + OTelStatusCodeOk = OTelStatusCodeKey.String("OK") + // The operation contains an error. + // Stability: stable + OTelStatusCodeError = OTelStatusCodeKey.String("ERROR") +) + +// Namespace: peer +const ( + // PeerServiceKey is the attribute Key conforming to the "peer.service" semantic + // conventions. It represents the [`service.name`] of the remote service. SHOULD + // be equal to the actual `service.name` resource attribute of the remote + // service if any. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: AuthTokenCache + // + // [`service.name`]: /docs/resource/README.md#service + PeerServiceKey = attribute.Key("peer.service") +) + +// PeerService returns an attribute KeyValue conforming to the "peer.service" +// semantic conventions. It represents the [`service.name`] of the remote +// service. SHOULD be equal to the actual `service.name` resource attribute of +// the remote service if any. +// +// [`service.name`]: /docs/resource/README.md#service +func PeerService(val string) attribute.KeyValue { + return PeerServiceKey.String(val) +} + +// Namespace: process +const ( + // ProcessArgsCountKey is the attribute Key conforming to the + // "process.args_count" semantic conventions. It represents the length of the + // process.command_args array. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 4 + // Note: This field can be useful for querying or performing bucket analysis on + // how many arguments were provided to start a process. More arguments may be an + // indication of suspicious activity. + ProcessArgsCountKey = attribute.Key("process.args_count") + + // ProcessCommandKey is the attribute Key conforming to the "process.command" + // semantic conventions. It represents the command used to launch the process + // (i.e. the command name). On Linux based systems, can be set to the zeroth + // string in `proc/[pid]/cmdline`. On Windows, can be set to the first parameter + // extracted from `GetCommandLineW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cmd/otelcol" + ProcessCommandKey = attribute.Key("process.command") + + // ProcessCommandArgsKey is the attribute Key conforming to the + // "process.command_args" semantic conventions. It represents the all the + // command arguments (including the command/executable itself) as received by + // the process. On Linux-based systems (and some other Unixoid systems + // supporting procfs), can be set according to the list of null-delimited + // strings extracted from `proc/[pid]/cmdline`. For libc-based executables, this + // would be the full argv vector passed to `main`. SHOULD NOT be collected by + // default unless there is sanitization that excludes sensitive data. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cmd/otecol", "--config=config.yaml" + ProcessCommandArgsKey = attribute.Key("process.command_args") + + // ProcessCommandLineKey is the attribute Key conforming to the + // "process.command_line" semantic conventions. It represents the full command + // used to launch the process as a single string representing the full command. + // On Windows, can be set to the result of `GetCommandLineW`. Do not set this if + // you have to assemble it just for monitoring; use `process.command_args` + // instead. SHOULD NOT be collected by default unless there is sanitization that + // excludes sensitive data. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "C:\cmd\otecol --config="my directory\config.yaml"" + ProcessCommandLineKey = attribute.Key("process.command_line") + + // ProcessContextSwitchTypeKey is the attribute Key conforming to the + // "process.context_switch_type" semantic conventions. It represents the + // specifies whether the context switches for this data point were voluntary or + // involuntary. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessContextSwitchTypeKey = attribute.Key("process.context_switch_type") + + // ProcessCreationTimeKey is the attribute Key conforming to the + // "process.creation.time" semantic conventions. It represents the date and time + // the process was created, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2023-11-21T09:25:34.853Z" + ProcessCreationTimeKey = attribute.Key("process.creation.time") + + // ProcessExecutableBuildIDGNUKey is the attribute Key conforming to the + // "process.executable.build_id.gnu" semantic conventions. It represents the GNU + // build ID as found in the `.note.gnu.build-id` ELF section (hex string). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "c89b11207f6479603b0d49bf291c092c2b719293" + ProcessExecutableBuildIDGNUKey = attribute.Key("process.executable.build_id.gnu") + + // ProcessExecutableBuildIDGoKey is the attribute Key conforming to the + // "process.executable.build_id.go" semantic conventions. It represents the Go + // build ID as retrieved by `go tool buildid `. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "foh3mEXu7BLZjsN9pOwG/kATcXlYVCDEFouRMQed_/WwRFB1hPo9LBkekthSPG/x8hMC8emW2cCjXD0_1aY" + ProcessExecutableBuildIDGoKey = attribute.Key("process.executable.build_id.go") + + // ProcessExecutableBuildIDHtlhashKey is the attribute Key conforming to the + // "process.executable.build_id.htlhash" semantic conventions. It represents the + // profiling specific build ID for executables. See the OTel specification for + // Profiles for more information. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "600DCAFE4A110000F2BF38C493F5FB92" + ProcessExecutableBuildIDHtlhashKey = attribute.Key("process.executable.build_id.htlhash") + + // ProcessExecutableNameKey is the attribute Key conforming to the + // "process.executable.name" semantic conventions. It represents the name of the + // process executable. On Linux based systems, this SHOULD be set to the base + // name of the target of `/proc/[pid]/exe`. On Windows, this SHOULD be set to + // the base name of `GetProcessImageFileNameW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcol" + ProcessExecutableNameKey = attribute.Key("process.executable.name") + + // ProcessExecutablePathKey is the attribute Key conforming to the + // "process.executable.path" semantic conventions. It represents the full path + // to the process executable. On Linux based systems, can be set to the target + // of `proc/[pid]/exe`. On Windows, can be set to the result of + // `GetProcessImageFileNameW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/usr/bin/cmd/otelcol" + ProcessExecutablePathKey = attribute.Key("process.executable.path") + + // ProcessExitCodeKey is the attribute Key conforming to the "process.exit.code" + // semantic conventions. It represents the exit code of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 127 + ProcessExitCodeKey = attribute.Key("process.exit.code") + + // ProcessExitTimeKey is the attribute Key conforming to the "process.exit.time" + // semantic conventions. It represents the date and time the process exited, in + // ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2023-11-21T09:26:12.315Z" + ProcessExitTimeKey = attribute.Key("process.exit.time") + + // ProcessGroupLeaderPIDKey is the attribute Key conforming to the + // "process.group_leader.pid" semantic conventions. It represents the PID of the + // process's group leader. This is also the process group ID (PGID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 23 + ProcessGroupLeaderPIDKey = attribute.Key("process.group_leader.pid") + + // ProcessInteractiveKey is the attribute Key conforming to the + // "process.interactive" semantic conventions. It represents the whether the + // process is connected to an interactive shell. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessInteractiveKey = attribute.Key("process.interactive") + + // ProcessLinuxCgroupKey is the attribute Key conforming to the + // "process.linux.cgroup" semantic conventions. It represents the control group + // associated with the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1:name=systemd:/user.slice/user-1000.slice/session-3.scope", + // "0::/user.slice/user-1000.slice/user@1000.service/tmux-spawn-0267755b-4639-4a27-90ed-f19f88e53748.scope" + // Note: Control groups (cgroups) are a kernel feature used to organize and + // manage process resources. This attribute provides the path(s) to the + // cgroup(s) associated with the process, which should match the contents of the + // [/proc/[PID]/cgroup] file. + // + // [/proc/[PID]/cgroup]: https://man7.org/linux/man-pages/man7/cgroups.7.html + ProcessLinuxCgroupKey = attribute.Key("process.linux.cgroup") + + // ProcessOwnerKey is the attribute Key conforming to the "process.owner" + // semantic conventions. It represents the username of the user that owns the + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + ProcessOwnerKey = attribute.Key("process.owner") + + // ProcessPagingFaultTypeKey is the attribute Key conforming to the + // "process.paging.fault_type" semantic conventions. It represents the type of + // page fault for this data point. Type `major` is for major/hard page faults, + // and `minor` is for minor/soft page faults. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessPagingFaultTypeKey = attribute.Key("process.paging.fault_type") + + // ProcessParentPIDKey is the attribute Key conforming to the + // "process.parent_pid" semantic conventions. It represents the parent Process + // identifier (PPID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 111 + ProcessParentPIDKey = attribute.Key("process.parent_pid") + + // ProcessPIDKey is the attribute Key conforming to the "process.pid" semantic + // conventions. It represents the process identifier (PID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1234 + ProcessPIDKey = attribute.Key("process.pid") + + // ProcessRealUserIDKey is the attribute Key conforming to the + // "process.real_user.id" semantic conventions. It represents the real user ID + // (RUID) of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1000 + ProcessRealUserIDKey = attribute.Key("process.real_user.id") + + // ProcessRealUserNameKey is the attribute Key conforming to the + // "process.real_user.name" semantic conventions. It represents the username of + // the real user of the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "operator" + ProcessRealUserNameKey = attribute.Key("process.real_user.name") + + // ProcessRuntimeDescriptionKey is the attribute Key conforming to the + // "process.runtime.description" semantic conventions. It represents an + // additional description about the runtime of the process, for example a + // specific vendor customization of the runtime environment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: Eclipse OpenJ9 Eclipse OpenJ9 VM openj9-0.21.0 + ProcessRuntimeDescriptionKey = attribute.Key("process.runtime.description") + + // ProcessRuntimeNameKey is the attribute Key conforming to the + // "process.runtime.name" semantic conventions. It represents the name of the + // runtime of this process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "OpenJDK Runtime Environment" + ProcessRuntimeNameKey = attribute.Key("process.runtime.name") + + // ProcessRuntimeVersionKey is the attribute Key conforming to the + // "process.runtime.version" semantic conventions. It represents the version of + // the runtime of this process, as returned by the runtime without modification. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 14.0.2 + ProcessRuntimeVersionKey = attribute.Key("process.runtime.version") + + // ProcessSavedUserIDKey is the attribute Key conforming to the + // "process.saved_user.id" semantic conventions. It represents the saved user ID + // (SUID) of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1002 + ProcessSavedUserIDKey = attribute.Key("process.saved_user.id") + + // ProcessSavedUserNameKey is the attribute Key conforming to the + // "process.saved_user.name" semantic conventions. It represents the username of + // the saved user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "operator" + ProcessSavedUserNameKey = attribute.Key("process.saved_user.name") + + // ProcessSessionLeaderPIDKey is the attribute Key conforming to the + // "process.session_leader.pid" semantic conventions. It represents the PID of + // the process's session leader. This is also the session ID (SID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 14 + ProcessSessionLeaderPIDKey = attribute.Key("process.session_leader.pid") + + // ProcessTitleKey is the attribute Key conforming to the "process.title" + // semantic conventions. It represents the process title (proctitle). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cat /etc/hostname", "xfce4-session", "bash" + // Note: In many Unix-like systems, process title (proctitle), is the string + // that represents the name or command line of a running process, displayed by + // system monitoring tools like ps, top, and htop. + ProcessTitleKey = attribute.Key("process.title") + + // ProcessUserIDKey is the attribute Key conforming to the "process.user.id" + // semantic conventions. It represents the effective user ID (EUID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1001 + ProcessUserIDKey = attribute.Key("process.user.id") + + // ProcessUserNameKey is the attribute Key conforming to the "process.user.name" + // semantic conventions. It represents the username of the effective user of the + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + ProcessUserNameKey = attribute.Key("process.user.name") + + // ProcessVpidKey is the attribute Key conforming to the "process.vpid" semantic + // conventions. It represents the virtual process identifier. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12 + // Note: The process ID within a PID namespace. This is not necessarily unique + // across all processes on the host but it is unique within the process + // namespace that the process exists within. + ProcessVpidKey = attribute.Key("process.vpid") + + // ProcessWorkingDirectoryKey is the attribute Key conforming to the + // "process.working_directory" semantic conventions. It represents the working + // directory of the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/root" + ProcessWorkingDirectoryKey = attribute.Key("process.working_directory") +) + +// ProcessArgsCount returns an attribute KeyValue conforming to the +// "process.args_count" semantic conventions. It represents the length of the +// process.command_args array. +func ProcessArgsCount(val int) attribute.KeyValue { + return ProcessArgsCountKey.Int(val) +} + +// ProcessCommand returns an attribute KeyValue conforming to the +// "process.command" semantic conventions. It represents the command used to +// launch the process (i.e. the command name). On Linux based systems, can be set +// to the zeroth string in `proc/[pid]/cmdline`. On Windows, can be set to the +// first parameter extracted from `GetCommandLineW`. +func ProcessCommand(val string) attribute.KeyValue { + return ProcessCommandKey.String(val) +} + +// ProcessCommandArgs returns an attribute KeyValue conforming to the +// "process.command_args" semantic conventions. It represents the all the command +// arguments (including the command/executable itself) as received by the +// process. On Linux-based systems (and some other Unixoid systems supporting +// procfs), can be set according to the list of null-delimited strings extracted +// from `proc/[pid]/cmdline`. For libc-based executables, this would be the full +// argv vector passed to `main`. SHOULD NOT be collected by default unless there +// is sanitization that excludes sensitive data. +func ProcessCommandArgs(val ...string) attribute.KeyValue { + return ProcessCommandArgsKey.StringSlice(val) +} + +// ProcessCommandLine returns an attribute KeyValue conforming to the +// "process.command_line" semantic conventions. It represents the full command +// used to launch the process as a single string representing the full command. +// On Windows, can be set to the result of `GetCommandLineW`. Do not set this if +// you have to assemble it just for monitoring; use `process.command_args` +// instead. SHOULD NOT be collected by default unless there is sanitization that +// excludes sensitive data. +func ProcessCommandLine(val string) attribute.KeyValue { + return ProcessCommandLineKey.String(val) +} + +// ProcessCreationTime returns an attribute KeyValue conforming to the +// "process.creation.time" semantic conventions. It represents the date and time +// the process was created, in ISO 8601 format. +func ProcessCreationTime(val string) attribute.KeyValue { + return ProcessCreationTimeKey.String(val) +} + +// ProcessExecutableBuildIDGNU returns an attribute KeyValue conforming to the +// "process.executable.build_id.gnu" semantic conventions. It represents the GNU +// build ID as found in the `.note.gnu.build-id` ELF section (hex string). +func ProcessExecutableBuildIDGNU(val string) attribute.KeyValue { + return ProcessExecutableBuildIDGNUKey.String(val) +} + +// ProcessExecutableBuildIDGo returns an attribute KeyValue conforming to the +// "process.executable.build_id.go" semantic conventions. It represents the Go +// build ID as retrieved by `go tool buildid `. +func ProcessExecutableBuildIDGo(val string) attribute.KeyValue { + return ProcessExecutableBuildIDGoKey.String(val) +} + +// ProcessExecutableBuildIDHtlhash returns an attribute KeyValue conforming to +// the "process.executable.build_id.htlhash" semantic conventions. It represents +// the profiling specific build ID for executables. See the OTel specification +// for Profiles for more information. +func ProcessExecutableBuildIDHtlhash(val string) attribute.KeyValue { + return ProcessExecutableBuildIDHtlhashKey.String(val) +} + +// ProcessExecutableName returns an attribute KeyValue conforming to the +// "process.executable.name" semantic conventions. It represents the name of the +// process executable. On Linux based systems, this SHOULD be set to the base +// name of the target of `/proc/[pid]/exe`. On Windows, this SHOULD be set to the +// base name of `GetProcessImageFileNameW`. +func ProcessExecutableName(val string) attribute.KeyValue { + return ProcessExecutableNameKey.String(val) +} + +// ProcessExecutablePath returns an attribute KeyValue conforming to the +// "process.executable.path" semantic conventions. It represents the full path to +// the process executable. On Linux based systems, can be set to the target of +// `proc/[pid]/exe`. On Windows, can be set to the result of +// `GetProcessImageFileNameW`. +func ProcessExecutablePath(val string) attribute.KeyValue { + return ProcessExecutablePathKey.String(val) +} + +// ProcessExitCode returns an attribute KeyValue conforming to the +// "process.exit.code" semantic conventions. It represents the exit code of the +// process. +func ProcessExitCode(val int) attribute.KeyValue { + return ProcessExitCodeKey.Int(val) +} + +// ProcessExitTime returns an attribute KeyValue conforming to the +// "process.exit.time" semantic conventions. It represents the date and time the +// process exited, in ISO 8601 format. +func ProcessExitTime(val string) attribute.KeyValue { + return ProcessExitTimeKey.String(val) +} + +// ProcessGroupLeaderPID returns an attribute KeyValue conforming to the +// "process.group_leader.pid" semantic conventions. It represents the PID of the +// process's group leader. This is also the process group ID (PGID) of the +// process. +func ProcessGroupLeaderPID(val int) attribute.KeyValue { + return ProcessGroupLeaderPIDKey.Int(val) +} + +// ProcessInteractive returns an attribute KeyValue conforming to the +// "process.interactive" semantic conventions. It represents the whether the +// process is connected to an interactive shell. +func ProcessInteractive(val bool) attribute.KeyValue { + return ProcessInteractiveKey.Bool(val) +} + +// ProcessLinuxCgroup returns an attribute KeyValue conforming to the +// "process.linux.cgroup" semantic conventions. It represents the control group +// associated with the process. +func ProcessLinuxCgroup(val string) attribute.KeyValue { + return ProcessLinuxCgroupKey.String(val) +} + +// ProcessOwner returns an attribute KeyValue conforming to the "process.owner" +// semantic conventions. It represents the username of the user that owns the +// process. +func ProcessOwner(val string) attribute.KeyValue { + return ProcessOwnerKey.String(val) +} + +// ProcessParentPID returns an attribute KeyValue conforming to the +// "process.parent_pid" semantic conventions. It represents the parent Process +// identifier (PPID). +func ProcessParentPID(val int) attribute.KeyValue { + return ProcessParentPIDKey.Int(val) +} + +// ProcessPID returns an attribute KeyValue conforming to the "process.pid" +// semantic conventions. It represents the process identifier (PID). +func ProcessPID(val int) attribute.KeyValue { + return ProcessPIDKey.Int(val) +} + +// ProcessRealUserID returns an attribute KeyValue conforming to the +// "process.real_user.id" semantic conventions. It represents the real user ID +// (RUID) of the process. +func ProcessRealUserID(val int) attribute.KeyValue { + return ProcessRealUserIDKey.Int(val) +} + +// ProcessRealUserName returns an attribute KeyValue conforming to the +// "process.real_user.name" semantic conventions. It represents the username of +// the real user of the process. +func ProcessRealUserName(val string) attribute.KeyValue { + return ProcessRealUserNameKey.String(val) +} + +// ProcessRuntimeDescription returns an attribute KeyValue conforming to the +// "process.runtime.description" semantic conventions. It represents an +// additional description about the runtime of the process, for example a +// specific vendor customization of the runtime environment. +func ProcessRuntimeDescription(val string) attribute.KeyValue { + return ProcessRuntimeDescriptionKey.String(val) +} + +// ProcessRuntimeName returns an attribute KeyValue conforming to the +// "process.runtime.name" semantic conventions. It represents the name of the +// runtime of this process. +func ProcessRuntimeName(val string) attribute.KeyValue { + return ProcessRuntimeNameKey.String(val) +} + +// ProcessRuntimeVersion returns an attribute KeyValue conforming to the +// "process.runtime.version" semantic conventions. It represents the version of +// the runtime of this process, as returned by the runtime without modification. +func ProcessRuntimeVersion(val string) attribute.KeyValue { + return ProcessRuntimeVersionKey.String(val) +} + +// ProcessSavedUserID returns an attribute KeyValue conforming to the +// "process.saved_user.id" semantic conventions. It represents the saved user ID +// (SUID) of the process. +func ProcessSavedUserID(val int) attribute.KeyValue { + return ProcessSavedUserIDKey.Int(val) +} + +// ProcessSavedUserName returns an attribute KeyValue conforming to the +// "process.saved_user.name" semantic conventions. It represents the username of +// the saved user. +func ProcessSavedUserName(val string) attribute.KeyValue { + return ProcessSavedUserNameKey.String(val) +} + +// ProcessSessionLeaderPID returns an attribute KeyValue conforming to the +// "process.session_leader.pid" semantic conventions. It represents the PID of +// the process's session leader. This is also the session ID (SID) of the +// process. +func ProcessSessionLeaderPID(val int) attribute.KeyValue { + return ProcessSessionLeaderPIDKey.Int(val) +} + +// ProcessTitle returns an attribute KeyValue conforming to the "process.title" +// semantic conventions. It represents the process title (proctitle). +func ProcessTitle(val string) attribute.KeyValue { + return ProcessTitleKey.String(val) +} + +// ProcessUserID returns an attribute KeyValue conforming to the +// "process.user.id" semantic conventions. It represents the effective user ID +// (EUID) of the process. +func ProcessUserID(val int) attribute.KeyValue { + return ProcessUserIDKey.Int(val) +} + +// ProcessUserName returns an attribute KeyValue conforming to the +// "process.user.name" semantic conventions. It represents the username of the +// effective user of the process. +func ProcessUserName(val string) attribute.KeyValue { + return ProcessUserNameKey.String(val) +} + +// ProcessVpid returns an attribute KeyValue conforming to the "process.vpid" +// semantic conventions. It represents the virtual process identifier. +func ProcessVpid(val int) attribute.KeyValue { + return ProcessVpidKey.Int(val) +} + +// ProcessWorkingDirectory returns an attribute KeyValue conforming to the +// "process.working_directory" semantic conventions. It represents the working +// directory of the process. +func ProcessWorkingDirectory(val string) attribute.KeyValue { + return ProcessWorkingDirectoryKey.String(val) +} + +// Enum values for process.context_switch_type +var ( + // voluntary + // Stability: development + ProcessContextSwitchTypeVoluntary = ProcessContextSwitchTypeKey.String("voluntary") + // involuntary + // Stability: development + ProcessContextSwitchTypeInvoluntary = ProcessContextSwitchTypeKey.String("involuntary") +) + +// Enum values for process.paging.fault_type +var ( + // major + // Stability: development + ProcessPagingFaultTypeMajor = ProcessPagingFaultTypeKey.String("major") + // minor + // Stability: development + ProcessPagingFaultTypeMinor = ProcessPagingFaultTypeKey.String("minor") +) + +// Namespace: profile +const ( + // ProfileFrameTypeKey is the attribute Key conforming to the + // "profile.frame.type" semantic conventions. It represents the describes the + // interpreter or compiler of a single frame. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cpython" + ProfileFrameTypeKey = attribute.Key("profile.frame.type") +) + +// Enum values for profile.frame.type +var ( + // [.NET] + // + // Stability: development + // + // [.NET]: https://wikipedia.org/wiki/.NET + ProfileFrameTypeDotnet = ProfileFrameTypeKey.String("dotnet") + // [JVM] + // + // Stability: development + // + // [JVM]: https://wikipedia.org/wiki/Java_virtual_machine + ProfileFrameTypeJVM = ProfileFrameTypeKey.String("jvm") + // [Kernel] + // + // Stability: development + // + // [Kernel]: https://wikipedia.org/wiki/Kernel_(operating_system) + ProfileFrameTypeKernel = ProfileFrameTypeKey.String("kernel") + // Can be one of but not limited to [C], [C++], [Go] or [Rust]. If possible, a + // more precise value MUST be used. + // + // Stability: development + // + // [C]: https://wikipedia.org/wiki/C_(programming_language) + // [C++]: https://wikipedia.org/wiki/C%2B%2B + // [Go]: https://wikipedia.org/wiki/Go_(programming_language) + // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language) + ProfileFrameTypeNative = ProfileFrameTypeKey.String("native") + // [Perl] + // + // Stability: development + // + // [Perl]: https://wikipedia.org/wiki/Perl + ProfileFrameTypePerl = ProfileFrameTypeKey.String("perl") + // [PHP] + // + // Stability: development + // + // [PHP]: https://wikipedia.org/wiki/PHP + ProfileFrameTypePHP = ProfileFrameTypeKey.String("php") + // [Python] + // + // Stability: development + // + // [Python]: https://wikipedia.org/wiki/Python_(programming_language) + ProfileFrameTypeCpython = ProfileFrameTypeKey.String("cpython") + // [Ruby] + // + // Stability: development + // + // [Ruby]: https://wikipedia.org/wiki/Ruby_(programming_language) + ProfileFrameTypeRuby = ProfileFrameTypeKey.String("ruby") + // [V8JS] + // + // Stability: development + // + // [V8JS]: https://wikipedia.org/wiki/V8_(JavaScript_engine) + ProfileFrameTypeV8JS = ProfileFrameTypeKey.String("v8js") + // [Erlang] + // + // Stability: development + // + // [Erlang]: https://en.wikipedia.org/wiki/BEAM_(Erlang_virtual_machine) + ProfileFrameTypeBeam = ProfileFrameTypeKey.String("beam") + // [Go], + // + // Stability: development + // + // [Go]: https://wikipedia.org/wiki/Go_(programming_language) + ProfileFrameTypeGo = ProfileFrameTypeKey.String("go") + // [Rust] + // + // Stability: development + // + // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language) + ProfileFrameTypeRust = ProfileFrameTypeKey.String("rust") +) + +// Namespace: rpc +const ( + // RPCConnectRPCErrorCodeKey is the attribute Key conforming to the + // "rpc.connect_rpc.error_code" semantic conventions. It represents the + // [error codes] of the Connect request. Error codes are always string values. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [error codes]: https://connectrpc.com//docs/protocol/#error-codes + RPCConnectRPCErrorCodeKey = attribute.Key("rpc.connect_rpc.error_code") + + // RPCGRPCStatusCodeKey is the attribute Key conforming to the + // "rpc.grpc.status_code" semantic conventions. It represents the + // [numeric status code] of the gRPC request. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [numeric status code]: https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md + RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code") + + // RPCJSONRPCErrorCodeKey is the attribute Key conforming to the + // "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code` + // property of response if it is an error response. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: -32700, 100 + RPCJSONRPCErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code") + + // RPCJSONRPCErrorMessageKey is the attribute Key conforming to the + // "rpc.jsonrpc.error_message" semantic conventions. It represents the + // `error.message` property of response if it is an error response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Parse error", "User already exists" + RPCJSONRPCErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message") + + // RPCJSONRPCRequestIDKey is the attribute Key conforming to the + // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` + // property of request or response. Since protocol allows id to be int, string, + // `null` or missing (for notifications), value is expected to be cast to string + // for simplicity. Use empty string in case of `null` value. Omit entirely if + // this is a notification. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "10", "request-7", "" + RPCJSONRPCRequestIDKey = attribute.Key("rpc.jsonrpc.request_id") + + // RPCJSONRPCVersionKey is the attribute Key conforming to the + // "rpc.jsonrpc.version" semantic conventions. It represents the protocol + // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 + // doesn't specify this, the value can be omitted. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2.0", "1.0" + RPCJSONRPCVersionKey = attribute.Key("rpc.jsonrpc.version") + + // RPCMessageCompressedSizeKey is the attribute Key conforming to the + // "rpc.message.compressed_size" semantic conventions. It represents the + // compressed size of the message in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageCompressedSizeKey = attribute.Key("rpc.message.compressed_size") + + // RPCMessageIDKey is the attribute Key conforming to the "rpc.message.id" + // semantic conventions. It MUST be calculated as two different counters + // starting from `1` one for sent messages and one for received message.. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This way we guarantee that the values will be consistent between + // different implementations. + RPCMessageIDKey = attribute.Key("rpc.message.id") + + // RPCMessageTypeKey is the attribute Key conforming to the "rpc.message.type" + // semantic conventions. It represents the whether this is a received or sent + // message. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageTypeKey = attribute.Key("rpc.message.type") + + // RPCMessageUncompressedSizeKey is the attribute Key conforming to the + // "rpc.message.uncompressed_size" semantic conventions. It represents the + // uncompressed size of the message in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageUncompressedSizeKey = attribute.Key("rpc.message.uncompressed_size") + + // RPCMethodKey is the attribute Key conforming to the "rpc.method" semantic + // conventions. It represents the name of the (logical) method being called, + // must be equal to the $method part in the span name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: exampleMethod + // Note: This is the logical name of the method from the RPC interface + // perspective, which can be different from the name of any implementing + // method/function. The `code.function.name` attribute may be used to store the + // latter (e.g., method actually executing the call on the server side, RPC + // client stub method on the client side). + RPCMethodKey = attribute.Key("rpc.method") + + // RPCServiceKey is the attribute Key conforming to the "rpc.service" semantic + // conventions. It represents the full (logical) name of the service being + // called, including its package name, if applicable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myservice.EchoService + // Note: This is the logical name of the service from the RPC interface + // perspective, which can be different from the name of any implementing class. + // The `code.namespace` attribute may be used to store the latter (despite the + // attribute name, it may include a class name; e.g., class with method actually + // executing the call on the server side, RPC client stub class on the client + // side). + RPCServiceKey = attribute.Key("rpc.service") + + // RPCSystemKey is the attribute Key conforming to the "rpc.system" semantic + // conventions. It represents a string identifying the remoting system. See + // below for a list of well-known identifiers. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCSystemKey = attribute.Key("rpc.system") +) + +// RPCJSONRPCErrorCode returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code` +// property of response if it is an error response. +func RPCJSONRPCErrorCode(val int) attribute.KeyValue { + return RPCJSONRPCErrorCodeKey.Int(val) +} + +// RPCJSONRPCErrorMessage returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.error_message" semantic conventions. It represents the +// `error.message` property of response if it is an error response. +func RPCJSONRPCErrorMessage(val string) attribute.KeyValue { + return RPCJSONRPCErrorMessageKey.String(val) +} + +// RPCJSONRPCRequestID returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` property +// of request or response. Since protocol allows id to be int, string, `null` or +// missing (for notifications), value is expected to be cast to string for +// simplicity. Use empty string in case of `null` value. Omit entirely if this is +// a notification. +func RPCJSONRPCRequestID(val string) attribute.KeyValue { + return RPCJSONRPCRequestIDKey.String(val) +} + +// RPCJSONRPCVersion returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.version" semantic conventions. It represents the protocol version +// as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 doesn't +// specify this, the value can be omitted. +func RPCJSONRPCVersion(val string) attribute.KeyValue { + return RPCJSONRPCVersionKey.String(val) +} + +// RPCMessageCompressedSize returns an attribute KeyValue conforming to the +// "rpc.message.compressed_size" semantic conventions. It represents the +// compressed size of the message in bytes. +func RPCMessageCompressedSize(val int) attribute.KeyValue { + return RPCMessageCompressedSizeKey.Int(val) +} + +// RPCMessageID returns an attribute KeyValue conforming to the "rpc.message.id" +// semantic conventions. It MUST be calculated as two different counters starting +// from `1` one for sent messages and one for received message.. +func RPCMessageID(val int) attribute.KeyValue { + return RPCMessageIDKey.Int(val) +} + +// RPCMessageUncompressedSize returns an attribute KeyValue conforming to the +// "rpc.message.uncompressed_size" semantic conventions. It represents the +// uncompressed size of the message in bytes. +func RPCMessageUncompressedSize(val int) attribute.KeyValue { + return RPCMessageUncompressedSizeKey.Int(val) +} + +// RPCMethod returns an attribute KeyValue conforming to the "rpc.method" +// semantic conventions. It represents the name of the (logical) method being +// called, must be equal to the $method part in the span name. +func RPCMethod(val string) attribute.KeyValue { + return RPCMethodKey.String(val) +} + +// RPCService returns an attribute KeyValue conforming to the "rpc.service" +// semantic conventions. It represents the full (logical) name of the service +// being called, including its package name, if applicable. +func RPCService(val string) attribute.KeyValue { + return RPCServiceKey.String(val) +} + +// Enum values for rpc.connect_rpc.error_code +var ( + // cancelled + // Stability: development + RPCConnectRPCErrorCodeCancelled = RPCConnectRPCErrorCodeKey.String("cancelled") + // unknown + // Stability: development + RPCConnectRPCErrorCodeUnknown = RPCConnectRPCErrorCodeKey.String("unknown") + // invalid_argument + // Stability: development + RPCConnectRPCErrorCodeInvalidArgument = RPCConnectRPCErrorCodeKey.String("invalid_argument") + // deadline_exceeded + // Stability: development + RPCConnectRPCErrorCodeDeadlineExceeded = RPCConnectRPCErrorCodeKey.String("deadline_exceeded") + // not_found + // Stability: development + RPCConnectRPCErrorCodeNotFound = RPCConnectRPCErrorCodeKey.String("not_found") + // already_exists + // Stability: development + RPCConnectRPCErrorCodeAlreadyExists = RPCConnectRPCErrorCodeKey.String("already_exists") + // permission_denied + // Stability: development + RPCConnectRPCErrorCodePermissionDenied = RPCConnectRPCErrorCodeKey.String("permission_denied") + // resource_exhausted + // Stability: development + RPCConnectRPCErrorCodeResourceExhausted = RPCConnectRPCErrorCodeKey.String("resource_exhausted") + // failed_precondition + // Stability: development + RPCConnectRPCErrorCodeFailedPrecondition = RPCConnectRPCErrorCodeKey.String("failed_precondition") + // aborted + // Stability: development + RPCConnectRPCErrorCodeAborted = RPCConnectRPCErrorCodeKey.String("aborted") + // out_of_range + // Stability: development + RPCConnectRPCErrorCodeOutOfRange = RPCConnectRPCErrorCodeKey.String("out_of_range") + // unimplemented + // Stability: development + RPCConnectRPCErrorCodeUnimplemented = RPCConnectRPCErrorCodeKey.String("unimplemented") + // internal + // Stability: development + RPCConnectRPCErrorCodeInternal = RPCConnectRPCErrorCodeKey.String("internal") + // unavailable + // Stability: development + RPCConnectRPCErrorCodeUnavailable = RPCConnectRPCErrorCodeKey.String("unavailable") + // data_loss + // Stability: development + RPCConnectRPCErrorCodeDataLoss = RPCConnectRPCErrorCodeKey.String("data_loss") + // unauthenticated + // Stability: development + RPCConnectRPCErrorCodeUnauthenticated = RPCConnectRPCErrorCodeKey.String("unauthenticated") +) + +// Enum values for rpc.grpc.status_code +var ( + // OK + // Stability: development + RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0) + // CANCELLED + // Stability: development + RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1) + // UNKNOWN + // Stability: development + RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2) + // INVALID_ARGUMENT + // Stability: development + RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3) + // DEADLINE_EXCEEDED + // Stability: development + RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4) + // NOT_FOUND + // Stability: development + RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5) + // ALREADY_EXISTS + // Stability: development + RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6) + // PERMISSION_DENIED + // Stability: development + RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7) + // RESOURCE_EXHAUSTED + // Stability: development + RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8) + // FAILED_PRECONDITION + // Stability: development + RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9) + // ABORTED + // Stability: development + RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10) + // OUT_OF_RANGE + // Stability: development + RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11) + // UNIMPLEMENTED + // Stability: development + RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12) + // INTERNAL + // Stability: development + RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13) + // UNAVAILABLE + // Stability: development + RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14) + // DATA_LOSS + // Stability: development + RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15) + // UNAUTHENTICATED + // Stability: development + RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16) +) + +// Enum values for rpc.message.type +var ( + // sent + // Stability: development + RPCMessageTypeSent = RPCMessageTypeKey.String("SENT") + // received + // Stability: development + RPCMessageTypeReceived = RPCMessageTypeKey.String("RECEIVED") +) + +// Enum values for rpc.system +var ( + // gRPC + // Stability: development + RPCSystemGRPC = RPCSystemKey.String("grpc") + // Java RMI + // Stability: development + RPCSystemJavaRmi = RPCSystemKey.String("java_rmi") + // .NET WCF + // Stability: development + RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf") + // Apache Dubbo + // Stability: development + RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo") + // Connect RPC + // Stability: development + RPCSystemConnectRPC = RPCSystemKey.String("connect_rpc") +) + +// Namespace: security_rule +const ( + // SecurityRuleCategoryKey is the attribute Key conforming to the + // "security_rule.category" semantic conventions. It represents a categorization + // value keyword used by the entity using the rule for detection of this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Attempted Information Leak" + SecurityRuleCategoryKey = attribute.Key("security_rule.category") + + // SecurityRuleDescriptionKey is the attribute Key conforming to the + // "security_rule.description" semantic conventions. It represents the + // description of the rule generating the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Block requests to public DNS over HTTPS / TLS protocols" + SecurityRuleDescriptionKey = attribute.Key("security_rule.description") + + // SecurityRuleLicenseKey is the attribute Key conforming to the + // "security_rule.license" semantic conventions. It represents the name of the + // license under which the rule used to generate this event is made available. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Apache 2.0" + SecurityRuleLicenseKey = attribute.Key("security_rule.license") + + // SecurityRuleNameKey is the attribute Key conforming to the + // "security_rule.name" semantic conventions. It represents the name of the rule + // or signature generating the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "BLOCK_DNS_over_TLS" + SecurityRuleNameKey = attribute.Key("security_rule.name") + + // SecurityRuleReferenceKey is the attribute Key conforming to the + // "security_rule.reference" semantic conventions. It represents the reference + // URL to additional information about the rule used to generate this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://en.wikipedia.org/wiki/DNS_over_TLS" + // Note: The URL can point to the vendor’s documentation about the rule. If + // that’s not available, it can also be a link to a more general page + // describing this type of alert. + SecurityRuleReferenceKey = attribute.Key("security_rule.reference") + + // SecurityRuleRulesetNameKey is the attribute Key conforming to the + // "security_rule.ruleset.name" semantic conventions. It represents the name of + // the ruleset, policy, group, or parent category in which the rule used to + // generate this event is a member. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Standard_Protocol_Filters" + SecurityRuleRulesetNameKey = attribute.Key("security_rule.ruleset.name") + + // SecurityRuleUUIDKey is the attribute Key conforming to the + // "security_rule.uuid" semantic conventions. It represents a rule ID that is + // unique within the scope of a set or group of agents, observers, or other + // entities using the rule for detection of this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "550e8400-e29b-41d4-a716-446655440000", "1100110011" + SecurityRuleUUIDKey = attribute.Key("security_rule.uuid") + + // SecurityRuleVersionKey is the attribute Key conforming to the + // "security_rule.version" semantic conventions. It represents the version / + // revision of the rule being used for analysis. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.0.0" + SecurityRuleVersionKey = attribute.Key("security_rule.version") +) + +// SecurityRuleCategory returns an attribute KeyValue conforming to the +// "security_rule.category" semantic conventions. It represents a categorization +// value keyword used by the entity using the rule for detection of this event. +func SecurityRuleCategory(val string) attribute.KeyValue { + return SecurityRuleCategoryKey.String(val) +} + +// SecurityRuleDescription returns an attribute KeyValue conforming to the +// "security_rule.description" semantic conventions. It represents the +// description of the rule generating the event. +func SecurityRuleDescription(val string) attribute.KeyValue { + return SecurityRuleDescriptionKey.String(val) +} + +// SecurityRuleLicense returns an attribute KeyValue conforming to the +// "security_rule.license" semantic conventions. It represents the name of the +// license under which the rule used to generate this event is made available. +func SecurityRuleLicense(val string) attribute.KeyValue { + return SecurityRuleLicenseKey.String(val) +} + +// SecurityRuleName returns an attribute KeyValue conforming to the +// "security_rule.name" semantic conventions. It represents the name of the rule +// or signature generating the event. +func SecurityRuleName(val string) attribute.KeyValue { + return SecurityRuleNameKey.String(val) +} + +// SecurityRuleReference returns an attribute KeyValue conforming to the +// "security_rule.reference" semantic conventions. It represents the reference +// URL to additional information about the rule used to generate this event. +func SecurityRuleReference(val string) attribute.KeyValue { + return SecurityRuleReferenceKey.String(val) +} + +// SecurityRuleRulesetName returns an attribute KeyValue conforming to the +// "security_rule.ruleset.name" semantic conventions. It represents the name of +// the ruleset, policy, group, or parent category in which the rule used to +// generate this event is a member. +func SecurityRuleRulesetName(val string) attribute.KeyValue { + return SecurityRuleRulesetNameKey.String(val) +} + +// SecurityRuleUUID returns an attribute KeyValue conforming to the +// "security_rule.uuid" semantic conventions. It represents a rule ID that is +// unique within the scope of a set or group of agents, observers, or other +// entities using the rule for detection of this event. +func SecurityRuleUUID(val string) attribute.KeyValue { + return SecurityRuleUUIDKey.String(val) +} + +// SecurityRuleVersion returns an attribute KeyValue conforming to the +// "security_rule.version" semantic conventions. It represents the version / +// revision of the rule being used for analysis. +func SecurityRuleVersion(val string) attribute.KeyValue { + return SecurityRuleVersionKey.String(val) +} + +// Namespace: server +const ( + // ServerAddressKey is the attribute Key conforming to the "server.address" + // semantic conventions. It represents the server domain name if available + // without reverse DNS lookup; otherwise, IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the client side, and when communicating through an + // intermediary, `server.address` SHOULD represent the server address behind any + // intermediaries, for example proxies, if it's available. + ServerAddressKey = attribute.Key("server.address") + + // ServerPortKey is the attribute Key conforming to the "server.port" semantic + // conventions. It represents the server port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 80, 8080, 443 + // Note: When observed from the client side, and when communicating through an + // intermediary, `server.port` SHOULD represent the server port behind any + // intermediaries, for example proxies, if it's available. + ServerPortKey = attribute.Key("server.port") +) + +// ServerAddress returns an attribute KeyValue conforming to the "server.address" +// semantic conventions. It represents the server domain name if available +// without reverse DNS lookup; otherwise, IP address or Unix domain socket name. +func ServerAddress(val string) attribute.KeyValue { + return ServerAddressKey.String(val) +} + +// ServerPort returns an attribute KeyValue conforming to the "server.port" +// semantic conventions. It represents the server port number. +func ServerPort(val int) attribute.KeyValue { + return ServerPortKey.Int(val) +} + +// Namespace: service +const ( + // ServiceInstanceIDKey is the attribute Key conforming to the + // "service.instance.id" semantic conventions. It represents the string ID of + // the service instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "627cc493-f310-47de-96bd-71410b7dec09" + // Note: MUST be unique for each instance of the same + // `service.namespace,service.name` pair (in other words + // `service.namespace,service.name,service.instance.id` triplet MUST be globally + // unique). The ID helps to + // distinguish instances of the same service that exist at the same time (e.g. + // instances of a horizontally scaled + // service). + // + // Implementations, such as SDKs, are recommended to generate a random Version 1 + // or Version 4 [RFC + // 4122] UUID, but are free to use an inherent unique ID as + // the source of + // this value if stability is desirable. In that case, the ID SHOULD be used as + // source of a UUID Version 5 and + // SHOULD use the following UUID as the namespace: + // `4d63009a-8d0f-11ee-aad7-4c796ed8e320`. + // + // UUIDs are typically recommended, as only an opaque value for the purposes of + // identifying a service instance is + // needed. Similar to what can be seen in the man page for the + // [`/etc/machine-id`] file, the underlying + // data, such as pod name and namespace should be treated as confidential, being + // the user's choice to expose it + // or not via another resource attribute. + // + // For applications running behind an application server (like unicorn), we do + // not recommend using one identifier + // for all processes participating in the application. Instead, it's recommended + // each division (e.g. a worker + // thread in unicorn) to have its own instance.id. + // + // It's not recommended for a Collector to set `service.instance.id` if it can't + // unambiguously determine the + // service instance that is generating that telemetry. For instance, creating an + // UUID based on `pod.name` will + // likely be wrong, as the Collector might not know from which container within + // that pod the telemetry originated. + // However, Collectors can set the `service.instance.id` if they can + // unambiguously determine the service instance + // for that telemetry. This is typically the case for scraping receivers, as + // they know the target address and + // port. + // + // [RFC + // 4122]: https://www.ietf.org/rfc/rfc4122.txt + // [`/etc/machine-id`]: https://www.freedesktop.org/software/systemd/man/latest/machine-id.html + ServiceInstanceIDKey = attribute.Key("service.instance.id") + + // ServiceNameKey is the attribute Key conforming to the "service.name" semantic + // conventions. It represents the logical name of the service. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "shoppingcart" + // Note: MUST be the same for all instances of horizontally scaled services. If + // the value was not specified, SDKs MUST fallback to `unknown_service:` + // concatenated with [`process.executable.name`], e.g. `unknown_service:bash`. + // If `process.executable.name` is not available, the value MUST be set to + // `unknown_service`. + // + // [`process.executable.name`]: process.md + ServiceNameKey = attribute.Key("service.name") + + // ServiceNamespaceKey is the attribute Key conforming to the + // "service.namespace" semantic conventions. It represents a namespace for + // `service.name`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Shop" + // Note: A string value having a meaning that helps to distinguish a group of + // services, for example the team name that owns a group of services. + // `service.name` is expected to be unique within the same namespace. If + // `service.namespace` is not specified in the Resource then `service.name` is + // expected to be unique for all services that have no explicit namespace + // defined (so the empty/unspecified namespace is simply one more valid + // namespace). Zero-length namespace string is assumed equal to unspecified + // namespace. + ServiceNamespaceKey = attribute.Key("service.namespace") + + // ServiceVersionKey is the attribute Key conforming to the "service.version" + // semantic conventions. It represents the version string of the service API or + // implementation. The format is not defined by these conventions. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "2.0.0", "a01dbef8a" + ServiceVersionKey = attribute.Key("service.version") +) + +// ServiceInstanceID returns an attribute KeyValue conforming to the +// "service.instance.id" semantic conventions. It represents the string ID of the +// service instance. +func ServiceInstanceID(val string) attribute.KeyValue { + return ServiceInstanceIDKey.String(val) +} + +// ServiceName returns an attribute KeyValue conforming to the "service.name" +// semantic conventions. It represents the logical name of the service. +func ServiceName(val string) attribute.KeyValue { + return ServiceNameKey.String(val) +} + +// ServiceNamespace returns an attribute KeyValue conforming to the +// "service.namespace" semantic conventions. It represents a namespace for +// `service.name`. +func ServiceNamespace(val string) attribute.KeyValue { + return ServiceNamespaceKey.String(val) +} + +// ServiceVersion returns an attribute KeyValue conforming to the +// "service.version" semantic conventions. It represents the version string of +// the service API or implementation. The format is not defined by these +// conventions. +func ServiceVersion(val string) attribute.KeyValue { + return ServiceVersionKey.String(val) +} + +// Namespace: session +const ( + // SessionIDKey is the attribute Key conforming to the "session.id" semantic + // conventions. It represents a unique id to identify a session. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 00112233-4455-6677-8899-aabbccddeeff + SessionIDKey = attribute.Key("session.id") + + // SessionPreviousIDKey is the attribute Key conforming to the + // "session.previous_id" semantic conventions. It represents the previous + // `session.id` for this user, when known. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 00112233-4455-6677-8899-aabbccddeeff + SessionPreviousIDKey = attribute.Key("session.previous_id") +) + +// SessionID returns an attribute KeyValue conforming to the "session.id" +// semantic conventions. It represents a unique id to identify a session. +func SessionID(val string) attribute.KeyValue { + return SessionIDKey.String(val) +} + +// SessionPreviousID returns an attribute KeyValue conforming to the +// "session.previous_id" semantic conventions. It represents the previous +// `session.id` for this user, when known. +func SessionPreviousID(val string) attribute.KeyValue { + return SessionPreviousIDKey.String(val) +} + +// Namespace: signalr +const ( + // SignalRConnectionStatusKey is the attribute Key conforming to the + // "signalr.connection.status" semantic conventions. It represents the signalR + // HTTP connection closure status. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "app_shutdown", "timeout" + SignalRConnectionStatusKey = attribute.Key("signalr.connection.status") + + // SignalRTransportKey is the attribute Key conforming to the + // "signalr.transport" semantic conventions. It represents the + // [SignalR transport type]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "web_sockets", "long_polling" + // + // [SignalR transport type]: https://github.com/dotnet/aspnetcore/blob/main/src/SignalR/docs/specs/TransportProtocols.md + SignalRTransportKey = attribute.Key("signalr.transport") +) + +// Enum values for signalr.connection.status +var ( + // The connection was closed normally. + // Stability: stable + SignalRConnectionStatusNormalClosure = SignalRConnectionStatusKey.String("normal_closure") + // The connection was closed due to a timeout. + // Stability: stable + SignalRConnectionStatusTimeout = SignalRConnectionStatusKey.String("timeout") + // The connection was closed because the app is shutting down. + // Stability: stable + SignalRConnectionStatusAppShutdown = SignalRConnectionStatusKey.String("app_shutdown") +) + +// Enum values for signalr.transport +var ( + // ServerSentEvents protocol + // Stability: stable + SignalRTransportServerSentEvents = SignalRTransportKey.String("server_sent_events") + // LongPolling protocol + // Stability: stable + SignalRTransportLongPolling = SignalRTransportKey.String("long_polling") + // WebSockets protocol + // Stability: stable + SignalRTransportWebSockets = SignalRTransportKey.String("web_sockets") +) + +// Namespace: source +const ( + // SourceAddressKey is the attribute Key conforming to the "source.address" + // semantic conventions. It represents the source address - domain name if + // available without reverse DNS lookup; otherwise, IP address or Unix domain + // socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "source.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the destination side, and when communicating through + // an intermediary, `source.address` SHOULD represent the source address behind + // any intermediaries, for example proxies, if it's available. + SourceAddressKey = attribute.Key("source.address") + + // SourcePortKey is the attribute Key conforming to the "source.port" semantic + // conventions. It represents the source port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3389, 2888 + SourcePortKey = attribute.Key("source.port") +) + +// SourceAddress returns an attribute KeyValue conforming to the "source.address" +// semantic conventions. It represents the source address - domain name if +// available without reverse DNS lookup; otherwise, IP address or Unix domain +// socket name. +func SourceAddress(val string) attribute.KeyValue { + return SourceAddressKey.String(val) +} + +// SourcePort returns an attribute KeyValue conforming to the "source.port" +// semantic conventions. It represents the source port number. +func SourcePort(val int) attribute.KeyValue { + return SourcePortKey.Int(val) +} + +// Namespace: system +const ( + // SystemCPULogicalNumberKey is the attribute Key conforming to the + // "system.cpu.logical_number" semantic conventions. It represents the + // deprecated, use `cpu.logical_number` instead. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + SystemCPULogicalNumberKey = attribute.Key("system.cpu.logical_number") + + // SystemDeviceKey is the attribute Key conforming to the "system.device" + // semantic conventions. It represents the device identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "(identifier)" + SystemDeviceKey = attribute.Key("system.device") + + // SystemFilesystemModeKey is the attribute Key conforming to the + // "system.filesystem.mode" semantic conventions. It represents the filesystem + // mode. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "rw, ro" + SystemFilesystemModeKey = attribute.Key("system.filesystem.mode") + + // SystemFilesystemMountpointKey is the attribute Key conforming to the + // "system.filesystem.mountpoint" semantic conventions. It represents the + // filesystem mount path. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/mnt/data" + SystemFilesystemMountpointKey = attribute.Key("system.filesystem.mountpoint") + + // SystemFilesystemStateKey is the attribute Key conforming to the + // "system.filesystem.state" semantic conventions. It represents the filesystem + // state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "used" + SystemFilesystemStateKey = attribute.Key("system.filesystem.state") + + // SystemFilesystemTypeKey is the attribute Key conforming to the + // "system.filesystem.type" semantic conventions. It represents the filesystem + // type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ext4" + SystemFilesystemTypeKey = attribute.Key("system.filesystem.type") + + // SystemMemoryStateKey is the attribute Key conforming to the + // "system.memory.state" semantic conventions. It represents the memory state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "free", "cached" + SystemMemoryStateKey = attribute.Key("system.memory.state") + + // SystemPagingDirectionKey is the attribute Key conforming to the + // "system.paging.direction" semantic conventions. It represents the paging + // access direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "in" + SystemPagingDirectionKey = attribute.Key("system.paging.direction") + + // SystemPagingStateKey is the attribute Key conforming to the + // "system.paging.state" semantic conventions. It represents the memory paging + // state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "free" + SystemPagingStateKey = attribute.Key("system.paging.state") + + // SystemPagingTypeKey is the attribute Key conforming to the + // "system.paging.type" semantic conventions. It represents the memory paging + // type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "minor" + SystemPagingTypeKey = attribute.Key("system.paging.type") + + // SystemProcessStatusKey is the attribute Key conforming to the + // "system.process.status" semantic conventions. It represents the process + // state, e.g., [Linux Process State Codes]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "running" + // + // [Linux Process State Codes]: https://man7.org/linux/man-pages/man1/ps.1.html#PROCESS_STATE_CODES + SystemProcessStatusKey = attribute.Key("system.process.status") +) + +// SystemCPULogicalNumber returns an attribute KeyValue conforming to the +// "system.cpu.logical_number" semantic conventions. It represents the +// deprecated, use `cpu.logical_number` instead. +func SystemCPULogicalNumber(val int) attribute.KeyValue { + return SystemCPULogicalNumberKey.Int(val) +} + +// SystemDevice returns an attribute KeyValue conforming to the "system.device" +// semantic conventions. It represents the device identifier. +func SystemDevice(val string) attribute.KeyValue { + return SystemDeviceKey.String(val) +} + +// SystemFilesystemMode returns an attribute KeyValue conforming to the +// "system.filesystem.mode" semantic conventions. It represents the filesystem +// mode. +func SystemFilesystemMode(val string) attribute.KeyValue { + return SystemFilesystemModeKey.String(val) +} + +// SystemFilesystemMountpoint returns an attribute KeyValue conforming to the +// "system.filesystem.mountpoint" semantic conventions. It represents the +// filesystem mount path. +func SystemFilesystemMountpoint(val string) attribute.KeyValue { + return SystemFilesystemMountpointKey.String(val) +} + +// Enum values for system.filesystem.state +var ( + // used + // Stability: development + SystemFilesystemStateUsed = SystemFilesystemStateKey.String("used") + // free + // Stability: development + SystemFilesystemStateFree = SystemFilesystemStateKey.String("free") + // reserved + // Stability: development + SystemFilesystemStateReserved = SystemFilesystemStateKey.String("reserved") +) + +// Enum values for system.filesystem.type +var ( + // fat32 + // Stability: development + SystemFilesystemTypeFat32 = SystemFilesystemTypeKey.String("fat32") + // exfat + // Stability: development + SystemFilesystemTypeExfat = SystemFilesystemTypeKey.String("exfat") + // ntfs + // Stability: development + SystemFilesystemTypeNtfs = SystemFilesystemTypeKey.String("ntfs") + // refs + // Stability: development + SystemFilesystemTypeRefs = SystemFilesystemTypeKey.String("refs") + // hfsplus + // Stability: development + SystemFilesystemTypeHfsplus = SystemFilesystemTypeKey.String("hfsplus") + // ext4 + // Stability: development + SystemFilesystemTypeExt4 = SystemFilesystemTypeKey.String("ext4") +) + +// Enum values for system.memory.state +var ( + // used + // Stability: development + SystemMemoryStateUsed = SystemMemoryStateKey.String("used") + // free + // Stability: development + SystemMemoryStateFree = SystemMemoryStateKey.String("free") + // Deprecated: Removed, report shared memory usage with + // `metric.system.memory.shared` metric. + SystemMemoryStateShared = SystemMemoryStateKey.String("shared") + // buffers + // Stability: development + SystemMemoryStateBuffers = SystemMemoryStateKey.String("buffers") + // cached + // Stability: development + SystemMemoryStateCached = SystemMemoryStateKey.String("cached") +) + +// Enum values for system.paging.direction +var ( + // in + // Stability: development + SystemPagingDirectionIn = SystemPagingDirectionKey.String("in") + // out + // Stability: development + SystemPagingDirectionOut = SystemPagingDirectionKey.String("out") +) + +// Enum values for system.paging.state +var ( + // used + // Stability: development + SystemPagingStateUsed = SystemPagingStateKey.String("used") + // free + // Stability: development + SystemPagingStateFree = SystemPagingStateKey.String("free") +) + +// Enum values for system.paging.type +var ( + // major + // Stability: development + SystemPagingTypeMajor = SystemPagingTypeKey.String("major") + // minor + // Stability: development + SystemPagingTypeMinor = SystemPagingTypeKey.String("minor") +) + +// Enum values for system.process.status +var ( + // running + // Stability: development + SystemProcessStatusRunning = SystemProcessStatusKey.String("running") + // sleeping + // Stability: development + SystemProcessStatusSleeping = SystemProcessStatusKey.String("sleeping") + // stopped + // Stability: development + SystemProcessStatusStopped = SystemProcessStatusKey.String("stopped") + // defunct + // Stability: development + SystemProcessStatusDefunct = SystemProcessStatusKey.String("defunct") +) + +// Namespace: telemetry +const ( + // TelemetryDistroNameKey is the attribute Key conforming to the + // "telemetry.distro.name" semantic conventions. It represents the name of the + // auto instrumentation agent or distribution, if used. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "parts-unlimited-java" + // Note: Official auto instrumentation agents and distributions SHOULD set the + // `telemetry.distro.name` attribute to + // a string starting with `opentelemetry-`, e.g. + // `opentelemetry-java-instrumentation`. + TelemetryDistroNameKey = attribute.Key("telemetry.distro.name") + + // TelemetryDistroVersionKey is the attribute Key conforming to the + // "telemetry.distro.version" semantic conventions. It represents the version + // string of the auto instrumentation agent or distribution, if used. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.2.3" + TelemetryDistroVersionKey = attribute.Key("telemetry.distro.version") + + // TelemetrySDKLanguageKey is the attribute Key conforming to the + // "telemetry.sdk.language" semantic conventions. It represents the language of + // the telemetry SDK. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + TelemetrySDKLanguageKey = attribute.Key("telemetry.sdk.language") + + // TelemetrySDKNameKey is the attribute Key conforming to the + // "telemetry.sdk.name" semantic conventions. It represents the name of the + // telemetry SDK as defined above. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "opentelemetry" + // Note: The OpenTelemetry SDK MUST set the `telemetry.sdk.name` attribute to + // `opentelemetry`. + // If another SDK, like a fork or a vendor-provided implementation, is used, + // this SDK MUST set the + // `telemetry.sdk.name` attribute to the fully-qualified class or module name of + // this SDK's main entry point + // or another suitable identifier depending on the language. + // The identifier `opentelemetry` is reserved and MUST NOT be used in this case. + // All custom identifiers SHOULD be stable across different versions of an + // implementation. + TelemetrySDKNameKey = attribute.Key("telemetry.sdk.name") + + // TelemetrySDKVersionKey is the attribute Key conforming to the + // "telemetry.sdk.version" semantic conventions. It represents the version + // string of the telemetry SDK. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.2.3" + TelemetrySDKVersionKey = attribute.Key("telemetry.sdk.version") +) + +// TelemetryDistroName returns an attribute KeyValue conforming to the +// "telemetry.distro.name" semantic conventions. It represents the name of the +// auto instrumentation agent or distribution, if used. +func TelemetryDistroName(val string) attribute.KeyValue { + return TelemetryDistroNameKey.String(val) +} + +// TelemetryDistroVersion returns an attribute KeyValue conforming to the +// "telemetry.distro.version" semantic conventions. It represents the version +// string of the auto instrumentation agent or distribution, if used. +func TelemetryDistroVersion(val string) attribute.KeyValue { + return TelemetryDistroVersionKey.String(val) +} + +// TelemetrySDKName returns an attribute KeyValue conforming to the +// "telemetry.sdk.name" semantic conventions. It represents the name of the +// telemetry SDK as defined above. +func TelemetrySDKName(val string) attribute.KeyValue { + return TelemetrySDKNameKey.String(val) +} + +// TelemetrySDKVersion returns an attribute KeyValue conforming to the +// "telemetry.sdk.version" semantic conventions. It represents the version string +// of the telemetry SDK. +func TelemetrySDKVersion(val string) attribute.KeyValue { + return TelemetrySDKVersionKey.String(val) +} + +// Enum values for telemetry.sdk.language +var ( + // cpp + // Stability: stable + TelemetrySDKLanguageCPP = TelemetrySDKLanguageKey.String("cpp") + // dotnet + // Stability: stable + TelemetrySDKLanguageDotnet = TelemetrySDKLanguageKey.String("dotnet") + // erlang + // Stability: stable + TelemetrySDKLanguageErlang = TelemetrySDKLanguageKey.String("erlang") + // go + // Stability: stable + TelemetrySDKLanguageGo = TelemetrySDKLanguageKey.String("go") + // java + // Stability: stable + TelemetrySDKLanguageJava = TelemetrySDKLanguageKey.String("java") + // nodejs + // Stability: stable + TelemetrySDKLanguageNodejs = TelemetrySDKLanguageKey.String("nodejs") + // php + // Stability: stable + TelemetrySDKLanguagePHP = TelemetrySDKLanguageKey.String("php") + // python + // Stability: stable + TelemetrySDKLanguagePython = TelemetrySDKLanguageKey.String("python") + // ruby + // Stability: stable + TelemetrySDKLanguageRuby = TelemetrySDKLanguageKey.String("ruby") + // rust + // Stability: stable + TelemetrySDKLanguageRust = TelemetrySDKLanguageKey.String("rust") + // swift + // Stability: stable + TelemetrySDKLanguageSwift = TelemetrySDKLanguageKey.String("swift") + // webjs + // Stability: stable + TelemetrySDKLanguageWebJS = TelemetrySDKLanguageKey.String("webjs") +) + +// Namespace: test +const ( + // TestCaseNameKey is the attribute Key conforming to the "test.case.name" + // semantic conventions. It represents the fully qualified human readable name + // of the [test case]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "org.example.TestCase1.test1", "example/tests/TestCase1.test1", + // "ExampleTestCase1_test1" + // + // [test case]: https://wikipedia.org/wiki/Test_case + TestCaseNameKey = attribute.Key("test.case.name") + + // TestCaseResultStatusKey is the attribute Key conforming to the + // "test.case.result.status" semantic conventions. It represents the status of + // the actual test case result from test execution. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pass", "fail" + TestCaseResultStatusKey = attribute.Key("test.case.result.status") + + // TestSuiteNameKey is the attribute Key conforming to the "test.suite.name" + // semantic conventions. It represents the human readable name of a [test suite] + // . + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TestSuite1" + // + // [test suite]: https://wikipedia.org/wiki/Test_suite + TestSuiteNameKey = attribute.Key("test.suite.name") + + // TestSuiteRunStatusKey is the attribute Key conforming to the + // "test.suite.run.status" semantic conventions. It represents the status of the + // test suite run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "skipped", "aborted", "timed_out", + // "in_progress" + TestSuiteRunStatusKey = attribute.Key("test.suite.run.status") +) + +// TestCaseName returns an attribute KeyValue conforming to the "test.case.name" +// semantic conventions. It represents the fully qualified human readable name of +// the [test case]. +// +// [test case]: https://wikipedia.org/wiki/Test_case +func TestCaseName(val string) attribute.KeyValue { + return TestCaseNameKey.String(val) +} + +// TestSuiteName returns an attribute KeyValue conforming to the +// "test.suite.name" semantic conventions. It represents the human readable name +// of a [test suite]. +// +// [test suite]: https://wikipedia.org/wiki/Test_suite +func TestSuiteName(val string) attribute.KeyValue { + return TestSuiteNameKey.String(val) +} + +// Enum values for test.case.result.status +var ( + // pass + // Stability: development + TestCaseResultStatusPass = TestCaseResultStatusKey.String("pass") + // fail + // Stability: development + TestCaseResultStatusFail = TestCaseResultStatusKey.String("fail") +) + +// Enum values for test.suite.run.status +var ( + // success + // Stability: development + TestSuiteRunStatusSuccess = TestSuiteRunStatusKey.String("success") + // failure + // Stability: development + TestSuiteRunStatusFailure = TestSuiteRunStatusKey.String("failure") + // skipped + // Stability: development + TestSuiteRunStatusSkipped = TestSuiteRunStatusKey.String("skipped") + // aborted + // Stability: development + TestSuiteRunStatusAborted = TestSuiteRunStatusKey.String("aborted") + // timed_out + // Stability: development + TestSuiteRunStatusTimedOut = TestSuiteRunStatusKey.String("timed_out") + // in_progress + // Stability: development + TestSuiteRunStatusInProgress = TestSuiteRunStatusKey.String("in_progress") +) + +// Namespace: thread +const ( + // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic + // conventions. It represents the current "managed" thread ID (as opposed to OS + // thread ID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + ThreadIDKey = attribute.Key("thread.id") + + // ThreadNameKey is the attribute Key conforming to the "thread.name" semantic + // conventions. It represents the current thread name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: main + ThreadNameKey = attribute.Key("thread.name") +) + +// ThreadID returns an attribute KeyValue conforming to the "thread.id" semantic +// conventions. It represents the current "managed" thread ID (as opposed to OS +// thread ID). +func ThreadID(val int) attribute.KeyValue { + return ThreadIDKey.Int(val) +} + +// ThreadName returns an attribute KeyValue conforming to the "thread.name" +// semantic conventions. It represents the current thread name. +func ThreadName(val string) attribute.KeyValue { + return ThreadNameKey.String(val) +} + +// Namespace: tls +const ( + // TLSCipherKey is the attribute Key conforming to the "tls.cipher" semantic + // conventions. It represents the string indicating the [cipher] used during the + // current connection. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TLS_RSA_WITH_3DES_EDE_CBC_SHA", + // "TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256" + // Note: The values allowed for `tls.cipher` MUST be one of the `Descriptions` + // of the [registered TLS Cipher Suits]. + // + // [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5 + // [registered TLS Cipher Suits]: https://www.iana.org/assignments/tls-parameters/tls-parameters.xhtml#table-tls-parameters-4 + TLSCipherKey = attribute.Key("tls.cipher") + + // TLSClientCertificateKey is the attribute Key conforming to the + // "tls.client.certificate" semantic conventions. It represents the PEM-encoded + // stand-alone certificate offered by the client. This is usually + // mutually-exclusive of `client.certificate_chain` since this value also exists + // in that list. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII..." + TLSClientCertificateKey = attribute.Key("tls.client.certificate") + + // TLSClientCertificateChainKey is the attribute Key conforming to the + // "tls.client.certificate_chain" semantic conventions. It represents the array + // of PEM-encoded certificates that make up the certificate chain offered by the + // client. This is usually mutually-exclusive of `client.certificate` since that + // value should be the first certificate in the chain. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII...", "MI..." + TLSClientCertificateChainKey = attribute.Key("tls.client.certificate_chain") + + // TLSClientHashMd5Key is the attribute Key conforming to the + // "tls.client.hash.md5" semantic conventions. It represents the certificate + // fingerprint using the MD5 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC" + TLSClientHashMd5Key = attribute.Key("tls.client.hash.md5") + + // TLSClientHashSha1Key is the attribute Key conforming to the + // "tls.client.hash.sha1" semantic conventions. It represents the certificate + // fingerprint using the SHA1 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A" + TLSClientHashSha1Key = attribute.Key("tls.client.hash.sha1") + + // TLSClientHashSha256Key is the attribute Key conforming to the + // "tls.client.hash.sha256" semantic conventions. It represents the certificate + // fingerprint using the SHA256 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0" + TLSClientHashSha256Key = attribute.Key("tls.client.hash.sha256") + + // TLSClientIssuerKey is the attribute Key conforming to the "tls.client.issuer" + // semantic conventions. It represents the distinguished name of [subject] of + // the issuer of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com" + // + // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 + TLSClientIssuerKey = attribute.Key("tls.client.issuer") + + // TLSClientJa3Key is the attribute Key conforming to the "tls.client.ja3" + // semantic conventions. It represents a hash that identifies clients based on + // how they perform an SSL/TLS handshake. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "d4e5b18d6b55c71272893221c96ba240" + TLSClientJa3Key = attribute.Key("tls.client.ja3") + + // TLSClientNotAfterKey is the attribute Key conforming to the + // "tls.client.not_after" semantic conventions. It represents the date/Time + // indicating when client certificate is no longer considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T00:00:00.000Z" + TLSClientNotAfterKey = attribute.Key("tls.client.not_after") + + // TLSClientNotBeforeKey is the attribute Key conforming to the + // "tls.client.not_before" semantic conventions. It represents the date/Time + // indicating when client certificate is first considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1970-01-01T00:00:00.000Z" + TLSClientNotBeforeKey = attribute.Key("tls.client.not_before") + + // TLSClientSubjectKey is the attribute Key conforming to the + // "tls.client.subject" semantic conventions. It represents the distinguished + // name of subject of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=myclient, OU=Documentation Team, DC=example, DC=com" + TLSClientSubjectKey = attribute.Key("tls.client.subject") + + // TLSClientSupportedCiphersKey is the attribute Key conforming to the + // "tls.client.supported_ciphers" semantic conventions. It represents the array + // of ciphers offered by the client during the client hello. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384", + // "TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384" + TLSClientSupportedCiphersKey = attribute.Key("tls.client.supported_ciphers") + + // TLSCurveKey is the attribute Key conforming to the "tls.curve" semantic + // conventions. It represents the string indicating the curve used for the given + // cipher, when applicable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "secp256r1" + TLSCurveKey = attribute.Key("tls.curve") + + // TLSEstablishedKey is the attribute Key conforming to the "tls.established" + // semantic conventions. It represents the boolean flag indicating if the TLS + // negotiation was successful and transitioned to an encrypted tunnel. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: true + TLSEstablishedKey = attribute.Key("tls.established") + + // TLSNextProtocolKey is the attribute Key conforming to the "tls.next_protocol" + // semantic conventions. It represents the string indicating the protocol being + // tunneled. Per the values in the [IANA registry], this string should be lower + // case. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "http/1.1" + // + // [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids + TLSNextProtocolKey = attribute.Key("tls.next_protocol") + + // TLSProtocolNameKey is the attribute Key conforming to the "tls.protocol.name" + // semantic conventions. It represents the normalized lowercase protocol name + // parsed from original string of the negotiated [SSL/TLS protocol version]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values + TLSProtocolNameKey = attribute.Key("tls.protocol.name") + + // TLSProtocolVersionKey is the attribute Key conforming to the + // "tls.protocol.version" semantic conventions. It represents the numeric part + // of the version parsed from the original string of the negotiated + // [SSL/TLS protocol version]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.2", "3" + // + // [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values + TLSProtocolVersionKey = attribute.Key("tls.protocol.version") + + // TLSResumedKey is the attribute Key conforming to the "tls.resumed" semantic + // conventions. It represents the boolean flag indicating if this TLS connection + // was resumed from an existing TLS negotiation. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: true + TLSResumedKey = attribute.Key("tls.resumed") + + // TLSServerCertificateKey is the attribute Key conforming to the + // "tls.server.certificate" semantic conventions. It represents the PEM-encoded + // stand-alone certificate offered by the server. This is usually + // mutually-exclusive of `server.certificate_chain` since this value also exists + // in that list. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII..." + TLSServerCertificateKey = attribute.Key("tls.server.certificate") + + // TLSServerCertificateChainKey is the attribute Key conforming to the + // "tls.server.certificate_chain" semantic conventions. It represents the array + // of PEM-encoded certificates that make up the certificate chain offered by the + // server. This is usually mutually-exclusive of `server.certificate` since that + // value should be the first certificate in the chain. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII...", "MI..." + TLSServerCertificateChainKey = attribute.Key("tls.server.certificate_chain") + + // TLSServerHashMd5Key is the attribute Key conforming to the + // "tls.server.hash.md5" semantic conventions. It represents the certificate + // fingerprint using the MD5 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC" + TLSServerHashMd5Key = attribute.Key("tls.server.hash.md5") + + // TLSServerHashSha1Key is the attribute Key conforming to the + // "tls.server.hash.sha1" semantic conventions. It represents the certificate + // fingerprint using the SHA1 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A" + TLSServerHashSha1Key = attribute.Key("tls.server.hash.sha1") + + // TLSServerHashSha256Key is the attribute Key conforming to the + // "tls.server.hash.sha256" semantic conventions. It represents the certificate + // fingerprint using the SHA256 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0" + TLSServerHashSha256Key = attribute.Key("tls.server.hash.sha256") + + // TLSServerIssuerKey is the attribute Key conforming to the "tls.server.issuer" + // semantic conventions. It represents the distinguished name of [subject] of + // the issuer of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com" + // + // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 + TLSServerIssuerKey = attribute.Key("tls.server.issuer") + + // TLSServerJa3sKey is the attribute Key conforming to the "tls.server.ja3s" + // semantic conventions. It represents a hash that identifies servers based on + // how they perform an SSL/TLS handshake. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "d4e5b18d6b55c71272893221c96ba240" + TLSServerJa3sKey = attribute.Key("tls.server.ja3s") + + // TLSServerNotAfterKey is the attribute Key conforming to the + // "tls.server.not_after" semantic conventions. It represents the date/Time + // indicating when server certificate is no longer considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T00:00:00.000Z" + TLSServerNotAfterKey = attribute.Key("tls.server.not_after") + + // TLSServerNotBeforeKey is the attribute Key conforming to the + // "tls.server.not_before" semantic conventions. It represents the date/Time + // indicating when server certificate is first considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1970-01-01T00:00:00.000Z" + TLSServerNotBeforeKey = attribute.Key("tls.server.not_before") + + // TLSServerSubjectKey is the attribute Key conforming to the + // "tls.server.subject" semantic conventions. It represents the distinguished + // name of subject of the x.509 certificate presented by the server. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=myserver, OU=Documentation Team, DC=example, DC=com" + TLSServerSubjectKey = attribute.Key("tls.server.subject") +) + +// TLSCipher returns an attribute KeyValue conforming to the "tls.cipher" +// semantic conventions. It represents the string indicating the [cipher] used +// during the current connection. +// +// [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5 +func TLSCipher(val string) attribute.KeyValue { + return TLSCipherKey.String(val) +} + +// TLSClientCertificate returns an attribute KeyValue conforming to the +// "tls.client.certificate" semantic conventions. It represents the PEM-encoded +// stand-alone certificate offered by the client. This is usually +// mutually-exclusive of `client.certificate_chain` since this value also exists +// in that list. +func TLSClientCertificate(val string) attribute.KeyValue { + return TLSClientCertificateKey.String(val) +} + +// TLSClientCertificateChain returns an attribute KeyValue conforming to the +// "tls.client.certificate_chain" semantic conventions. It represents the array +// of PEM-encoded certificates that make up the certificate chain offered by the +// client. This is usually mutually-exclusive of `client.certificate` since that +// value should be the first certificate in the chain. +func TLSClientCertificateChain(val ...string) attribute.KeyValue { + return TLSClientCertificateChainKey.StringSlice(val) +} + +// TLSClientHashMd5 returns an attribute KeyValue conforming to the +// "tls.client.hash.md5" semantic conventions. It represents the certificate +// fingerprint using the MD5 digest of DER-encoded version of certificate offered +// by the client. For consistency with other hash values, this value should be +// formatted as an uppercase hash. +func TLSClientHashMd5(val string) attribute.KeyValue { + return TLSClientHashMd5Key.String(val) +} + +// TLSClientHashSha1 returns an attribute KeyValue conforming to the +// "tls.client.hash.sha1" semantic conventions. It represents the certificate +// fingerprint using the SHA1 digest of DER-encoded version of certificate +// offered by the client. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSClientHashSha1(val string) attribute.KeyValue { + return TLSClientHashSha1Key.String(val) +} + +// TLSClientHashSha256 returns an attribute KeyValue conforming to the +// "tls.client.hash.sha256" semantic conventions. It represents the certificate +// fingerprint using the SHA256 digest of DER-encoded version of certificate +// offered by the client. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSClientHashSha256(val string) attribute.KeyValue { + return TLSClientHashSha256Key.String(val) +} + +// TLSClientIssuer returns an attribute KeyValue conforming to the +// "tls.client.issuer" semantic conventions. It represents the distinguished name +// of [subject] of the issuer of the x.509 certificate presented by the client. +// +// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 +func TLSClientIssuer(val string) attribute.KeyValue { + return TLSClientIssuerKey.String(val) +} + +// TLSClientJa3 returns an attribute KeyValue conforming to the "tls.client.ja3" +// semantic conventions. It represents a hash that identifies clients based on +// how they perform an SSL/TLS handshake. +func TLSClientJa3(val string) attribute.KeyValue { + return TLSClientJa3Key.String(val) +} + +// TLSClientNotAfter returns an attribute KeyValue conforming to the +// "tls.client.not_after" semantic conventions. It represents the date/Time +// indicating when client certificate is no longer considered valid. +func TLSClientNotAfter(val string) attribute.KeyValue { + return TLSClientNotAfterKey.String(val) +} + +// TLSClientNotBefore returns an attribute KeyValue conforming to the +// "tls.client.not_before" semantic conventions. It represents the date/Time +// indicating when client certificate is first considered valid. +func TLSClientNotBefore(val string) attribute.KeyValue { + return TLSClientNotBeforeKey.String(val) +} + +// TLSClientSubject returns an attribute KeyValue conforming to the +// "tls.client.subject" semantic conventions. It represents the distinguished +// name of subject of the x.509 certificate presented by the client. +func TLSClientSubject(val string) attribute.KeyValue { + return TLSClientSubjectKey.String(val) +} + +// TLSClientSupportedCiphers returns an attribute KeyValue conforming to the +// "tls.client.supported_ciphers" semantic conventions. It represents the array +// of ciphers offered by the client during the client hello. +func TLSClientSupportedCiphers(val ...string) attribute.KeyValue { + return TLSClientSupportedCiphersKey.StringSlice(val) +} + +// TLSCurve returns an attribute KeyValue conforming to the "tls.curve" semantic +// conventions. It represents the string indicating the curve used for the given +// cipher, when applicable. +func TLSCurve(val string) attribute.KeyValue { + return TLSCurveKey.String(val) +} + +// TLSEstablished returns an attribute KeyValue conforming to the +// "tls.established" semantic conventions. It represents the boolean flag +// indicating if the TLS negotiation was successful and transitioned to an +// encrypted tunnel. +func TLSEstablished(val bool) attribute.KeyValue { + return TLSEstablishedKey.Bool(val) +} + +// TLSNextProtocol returns an attribute KeyValue conforming to the +// "tls.next_protocol" semantic conventions. It represents the string indicating +// the protocol being tunneled. Per the values in the [IANA registry], this +// string should be lower case. +// +// [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids +func TLSNextProtocol(val string) attribute.KeyValue { + return TLSNextProtocolKey.String(val) +} + +// TLSProtocolVersion returns an attribute KeyValue conforming to the +// "tls.protocol.version" semantic conventions. It represents the numeric part of +// the version parsed from the original string of the negotiated +// [SSL/TLS protocol version]. +// +// [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values +func TLSProtocolVersion(val string) attribute.KeyValue { + return TLSProtocolVersionKey.String(val) +} + +// TLSResumed returns an attribute KeyValue conforming to the "tls.resumed" +// semantic conventions. It represents the boolean flag indicating if this TLS +// connection was resumed from an existing TLS negotiation. +func TLSResumed(val bool) attribute.KeyValue { + return TLSResumedKey.Bool(val) +} + +// TLSServerCertificate returns an attribute KeyValue conforming to the +// "tls.server.certificate" semantic conventions. It represents the PEM-encoded +// stand-alone certificate offered by the server. This is usually +// mutually-exclusive of `server.certificate_chain` since this value also exists +// in that list. +func TLSServerCertificate(val string) attribute.KeyValue { + return TLSServerCertificateKey.String(val) +} + +// TLSServerCertificateChain returns an attribute KeyValue conforming to the +// "tls.server.certificate_chain" semantic conventions. It represents the array +// of PEM-encoded certificates that make up the certificate chain offered by the +// server. This is usually mutually-exclusive of `server.certificate` since that +// value should be the first certificate in the chain. +func TLSServerCertificateChain(val ...string) attribute.KeyValue { + return TLSServerCertificateChainKey.StringSlice(val) +} + +// TLSServerHashMd5 returns an attribute KeyValue conforming to the +// "tls.server.hash.md5" semantic conventions. It represents the certificate +// fingerprint using the MD5 digest of DER-encoded version of certificate offered +// by the server. For consistency with other hash values, this value should be +// formatted as an uppercase hash. +func TLSServerHashMd5(val string) attribute.KeyValue { + return TLSServerHashMd5Key.String(val) +} + +// TLSServerHashSha1 returns an attribute KeyValue conforming to the +// "tls.server.hash.sha1" semantic conventions. It represents the certificate +// fingerprint using the SHA1 digest of DER-encoded version of certificate +// offered by the server. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSServerHashSha1(val string) attribute.KeyValue { + return TLSServerHashSha1Key.String(val) +} + +// TLSServerHashSha256 returns an attribute KeyValue conforming to the +// "tls.server.hash.sha256" semantic conventions. It represents the certificate +// fingerprint using the SHA256 digest of DER-encoded version of certificate +// offered by the server. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSServerHashSha256(val string) attribute.KeyValue { + return TLSServerHashSha256Key.String(val) +} + +// TLSServerIssuer returns an attribute KeyValue conforming to the +// "tls.server.issuer" semantic conventions. It represents the distinguished name +// of [subject] of the issuer of the x.509 certificate presented by the client. +// +// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 +func TLSServerIssuer(val string) attribute.KeyValue { + return TLSServerIssuerKey.String(val) +} + +// TLSServerJa3s returns an attribute KeyValue conforming to the +// "tls.server.ja3s" semantic conventions. It represents a hash that identifies +// servers based on how they perform an SSL/TLS handshake. +func TLSServerJa3s(val string) attribute.KeyValue { + return TLSServerJa3sKey.String(val) +} + +// TLSServerNotAfter returns an attribute KeyValue conforming to the +// "tls.server.not_after" semantic conventions. It represents the date/Time +// indicating when server certificate is no longer considered valid. +func TLSServerNotAfter(val string) attribute.KeyValue { + return TLSServerNotAfterKey.String(val) +} + +// TLSServerNotBefore returns an attribute KeyValue conforming to the +// "tls.server.not_before" semantic conventions. It represents the date/Time +// indicating when server certificate is first considered valid. +func TLSServerNotBefore(val string) attribute.KeyValue { + return TLSServerNotBeforeKey.String(val) +} + +// TLSServerSubject returns an attribute KeyValue conforming to the +// "tls.server.subject" semantic conventions. It represents the distinguished +// name of subject of the x.509 certificate presented by the server. +func TLSServerSubject(val string) attribute.KeyValue { + return TLSServerSubjectKey.String(val) +} + +// Enum values for tls.protocol.name +var ( + // ssl + // Stability: development + TLSProtocolNameSsl = TLSProtocolNameKey.String("ssl") + // tls + // Stability: development + TLSProtocolNameTLS = TLSProtocolNameKey.String("tls") +) + +// Namespace: url +const ( + // URLDomainKey is the attribute Key conforming to the "url.domain" semantic + // conventions. It represents the domain extracted from the `url.full`, such as + // "opentelemetry.io". + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "www.foo.bar", "opentelemetry.io", "3.12.167.2", + // "[1080:0:0:0:8:800:200C:417A]" + // Note: In some cases a URL may refer to an IP and/or port directly, without a + // domain name. In this case, the IP address would go to the domain field. If + // the URL contains a [literal IPv6 address] enclosed by `[` and `]`, the `[` + // and `]` characters should also be captured in the domain field. + // + // [literal IPv6 address]: https://www.rfc-editor.org/rfc/rfc2732#section-2 + URLDomainKey = attribute.Key("url.domain") + + // URLExtensionKey is the attribute Key conforming to the "url.extension" + // semantic conventions. It represents the file extension extracted from the + // `url.full`, excluding the leading dot. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "png", "gz" + // Note: The file extension is only set if it exists, as not every url has a + // file extension. When the file name has multiple extensions `example.tar.gz`, + // only the last one should be captured `gz`, not `tar.gz`. + URLExtensionKey = attribute.Key("url.extension") + + // URLFragmentKey is the attribute Key conforming to the "url.fragment" semantic + // conventions. It represents the [URI fragment] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "SemConv" + // + // [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5 + URLFragmentKey = attribute.Key("url.fragment") + + // URLFullKey is the attribute Key conforming to the "url.full" semantic + // conventions. It represents the absolute URL describing a network resource + // according to [RFC3986]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", "//localhost" + // Note: For network calls, URL usually has + // `scheme://host[:port][path][?query][#fragment]` format, where the fragment + // is not transmitted over HTTP, but if it is known, it SHOULD be included + // nevertheless. + // + // `url.full` MUST NOT contain credentials passed via URL in form of + // `https://username:password@www.example.com/`. + // In such case username and password SHOULD be redacted and attribute's value + // SHOULD be `https://REDACTED:REDACTED@www.example.com/`. + // + // `url.full` SHOULD capture the absolute URL when it is available (or can be + // reconstructed). + // + // Sensitive content provided in `url.full` SHOULD be scrubbed when + // instrumentations can identify it. + // + // + // Query string values for the following keys SHOULD be redacted by default and + // replaced by the + // value `REDACTED`: + // + // - [`AWSAccessKeyId`] + // - [`Signature`] + // - [`sig`] + // - [`X-Goog-Signature`] + // + // This list is subject to change over time. + // + // When a query string value is redacted, the query string key SHOULD still be + // preserved, e.g. + // `https://www.example.com/path?color=blue&sig=REDACTED`. + // + // [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986 + // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token + // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls + URLFullKey = attribute.Key("url.full") + + // URLOriginalKey is the attribute Key conforming to the "url.original" semantic + // conventions. It represents the unmodified original URL as seen in the event + // source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", + // "search?q=OpenTelemetry" + // Note: In network monitoring, the observed URL may be a full URL, whereas in + // access logs, the URL is often just represented as a path. This field is meant + // to represent the URL as it was observed, complete or not. + // `url.original` might contain credentials passed via URL in form of + // `https://username:password@www.example.com/`. In such case password and + // username SHOULD NOT be redacted and attribute's value SHOULD remain the same. + URLOriginalKey = attribute.Key("url.original") + + // URLPathKey is the attribute Key conforming to the "url.path" semantic + // conventions. It represents the [URI path] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "/search" + // Note: Sensitive content provided in `url.path` SHOULD be scrubbed when + // instrumentations can identify it. + // + // [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3 + URLPathKey = attribute.Key("url.path") + + // URLPortKey is the attribute Key conforming to the "url.port" semantic + // conventions. It represents the port extracted from the `url.full`. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 443 + URLPortKey = attribute.Key("url.port") + + // URLQueryKey is the attribute Key conforming to the "url.query" semantic + // conventions. It represents the [URI query] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "q=OpenTelemetry" + // Note: Sensitive content provided in `url.query` SHOULD be scrubbed when + // instrumentations can identify it. + // + // + // Query string values for the following keys SHOULD be redacted by default and + // replaced by the value `REDACTED`: + // + // - [`AWSAccessKeyId`] + // - [`Signature`] + // - [`sig`] + // - [`X-Goog-Signature`] + // + // This list is subject to change over time. + // + // When a query string value is redacted, the query string key SHOULD still be + // preserved, e.g. + // `q=OpenTelemetry&sig=REDACTED`. + // + // [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4 + // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token + // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls + URLQueryKey = attribute.Key("url.query") + + // URLRegisteredDomainKey is the attribute Key conforming to the + // "url.registered_domain" semantic conventions. It represents the highest + // registered url domain, stripped of the subdomain. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "example.com", "foo.co.uk" + // Note: This value can be determined precisely with the [public suffix list]. + // For example, the registered domain for `foo.example.com` is `example.com`. + // Trying to approximate this by simply taking the last two labels will not work + // well for TLDs such as `co.uk`. + // + // [public suffix list]: https://publicsuffix.org/ + URLRegisteredDomainKey = attribute.Key("url.registered_domain") + + // URLSchemeKey is the attribute Key conforming to the "url.scheme" semantic + // conventions. It represents the [URI scheme] component identifying the used + // protocol. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "https", "ftp", "telnet" + // + // [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1 + URLSchemeKey = attribute.Key("url.scheme") + + // URLSubdomainKey is the attribute Key conforming to the "url.subdomain" + // semantic conventions. It represents the subdomain portion of a fully + // qualified domain name includes all of the names except the host name under + // the registered_domain. In a partially qualified domain, or if the + // qualification level of the full name cannot be determined, subdomain contains + // all of the names below the registered domain. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "east", "sub2.sub1" + // Note: The subdomain portion of `www.east.mydomain.co.uk` is `east`. If the + // domain has multiple levels of subdomain, such as `sub2.sub1.example.com`, the + // subdomain field should contain `sub2.sub1`, with no trailing period. + URLSubdomainKey = attribute.Key("url.subdomain") + + // URLTemplateKey is the attribute Key conforming to the "url.template" semantic + // conventions. It represents the low-cardinality template of an + // [absolute path reference]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/users/{id}", "/users/:id", "/users?id={id}" + // + // [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2 + URLTemplateKey = attribute.Key("url.template") + + // URLTopLevelDomainKey is the attribute Key conforming to the + // "url.top_level_domain" semantic conventions. It represents the effective top + // level domain (eTLD), also known as the domain suffix, is the last part of the + // domain name. For example, the top level domain for example.com is `com`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "com", "co.uk" + // Note: This value can be determined precisely with the [public suffix list]. + // + // [public suffix list]: https://publicsuffix.org/ + URLTopLevelDomainKey = attribute.Key("url.top_level_domain") +) + +// URLDomain returns an attribute KeyValue conforming to the "url.domain" +// semantic conventions. It represents the domain extracted from the `url.full`, +// such as "opentelemetry.io". +func URLDomain(val string) attribute.KeyValue { + return URLDomainKey.String(val) +} + +// URLExtension returns an attribute KeyValue conforming to the "url.extension" +// semantic conventions. It represents the file extension extracted from the +// `url.full`, excluding the leading dot. +func URLExtension(val string) attribute.KeyValue { + return URLExtensionKey.String(val) +} + +// URLFragment returns an attribute KeyValue conforming to the "url.fragment" +// semantic conventions. It represents the [URI fragment] component. +// +// [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5 +func URLFragment(val string) attribute.KeyValue { + return URLFragmentKey.String(val) +} + +// URLFull returns an attribute KeyValue conforming to the "url.full" semantic +// conventions. It represents the absolute URL describing a network resource +// according to [RFC3986]. +// +// [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986 +func URLFull(val string) attribute.KeyValue { + return URLFullKey.String(val) +} + +// URLOriginal returns an attribute KeyValue conforming to the "url.original" +// semantic conventions. It represents the unmodified original URL as seen in the +// event source. +func URLOriginal(val string) attribute.KeyValue { + return URLOriginalKey.String(val) +} + +// URLPath returns an attribute KeyValue conforming to the "url.path" semantic +// conventions. It represents the [URI path] component. +// +// [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3 +func URLPath(val string) attribute.KeyValue { + return URLPathKey.String(val) +} + +// URLPort returns an attribute KeyValue conforming to the "url.port" semantic +// conventions. It represents the port extracted from the `url.full`. +func URLPort(val int) attribute.KeyValue { + return URLPortKey.Int(val) +} + +// URLQuery returns an attribute KeyValue conforming to the "url.query" semantic +// conventions. It represents the [URI query] component. +// +// [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4 +func URLQuery(val string) attribute.KeyValue { + return URLQueryKey.String(val) +} + +// URLRegisteredDomain returns an attribute KeyValue conforming to the +// "url.registered_domain" semantic conventions. It represents the highest +// registered url domain, stripped of the subdomain. +func URLRegisteredDomain(val string) attribute.KeyValue { + return URLRegisteredDomainKey.String(val) +} + +// URLScheme returns an attribute KeyValue conforming to the "url.scheme" +// semantic conventions. It represents the [URI scheme] component identifying the +// used protocol. +// +// [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1 +func URLScheme(val string) attribute.KeyValue { + return URLSchemeKey.String(val) +} + +// URLSubdomain returns an attribute KeyValue conforming to the "url.subdomain" +// semantic conventions. It represents the subdomain portion of a fully qualified +// domain name includes all of the names except the host name under the +// registered_domain. In a partially qualified domain, or if the qualification +// level of the full name cannot be determined, subdomain contains all of the +// names below the registered domain. +func URLSubdomain(val string) attribute.KeyValue { + return URLSubdomainKey.String(val) +} + +// URLTemplate returns an attribute KeyValue conforming to the "url.template" +// semantic conventions. It represents the low-cardinality template of an +// [absolute path reference]. +// +// [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2 +func URLTemplate(val string) attribute.KeyValue { + return URLTemplateKey.String(val) +} + +// URLTopLevelDomain returns an attribute KeyValue conforming to the +// "url.top_level_domain" semantic conventions. It represents the effective top +// level domain (eTLD), also known as the domain suffix, is the last part of the +// domain name. For example, the top level domain for example.com is `com`. +func URLTopLevelDomain(val string) attribute.KeyValue { + return URLTopLevelDomainKey.String(val) +} + +// Namespace: user +const ( + // UserEmailKey is the attribute Key conforming to the "user.email" semantic + // conventions. It represents the user email address. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a.einstein@example.com" + UserEmailKey = attribute.Key("user.email") + + // UserFullNameKey is the attribute Key conforming to the "user.full_name" + // semantic conventions. It represents the user's full name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Albert Einstein" + UserFullNameKey = attribute.Key("user.full_name") + + // UserHashKey is the attribute Key conforming to the "user.hash" semantic + // conventions. It represents the unique user hash to correlate information for + // a user in anonymized form. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "364fc68eaf4c8acec74a4e52d7d1feaa" + // Note: Useful if `user.id` or `user.name` contain confidential information and + // cannot be used. + UserHashKey = attribute.Key("user.hash") + + // UserIDKey is the attribute Key conforming to the "user.id" semantic + // conventions. It represents the unique identifier of the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "S-1-5-21-202424912787-2692429404-2351956786-1000" + UserIDKey = attribute.Key("user.id") + + // UserNameKey is the attribute Key conforming to the "user.name" semantic + // conventions. It represents the short name or login/username of the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a.einstein" + UserNameKey = attribute.Key("user.name") + + // UserRolesKey is the attribute Key conforming to the "user.roles" semantic + // conventions. It represents the array of user roles at the time of the event. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "admin", "reporting_user" + UserRolesKey = attribute.Key("user.roles") +) + +// UserEmail returns an attribute KeyValue conforming to the "user.email" +// semantic conventions. It represents the user email address. +func UserEmail(val string) attribute.KeyValue { + return UserEmailKey.String(val) +} + +// UserFullName returns an attribute KeyValue conforming to the "user.full_name" +// semantic conventions. It represents the user's full name. +func UserFullName(val string) attribute.KeyValue { + return UserFullNameKey.String(val) +} + +// UserHash returns an attribute KeyValue conforming to the "user.hash" semantic +// conventions. It represents the unique user hash to correlate information for a +// user in anonymized form. +func UserHash(val string) attribute.KeyValue { + return UserHashKey.String(val) +} + +// UserID returns an attribute KeyValue conforming to the "user.id" semantic +// conventions. It represents the unique identifier of the user. +func UserID(val string) attribute.KeyValue { + return UserIDKey.String(val) +} + +// UserName returns an attribute KeyValue conforming to the "user.name" semantic +// conventions. It represents the short name or login/username of the user. +func UserName(val string) attribute.KeyValue { + return UserNameKey.String(val) +} + +// UserRoles returns an attribute KeyValue conforming to the "user.roles" +// semantic conventions. It represents the array of user roles at the time of the +// event. +func UserRoles(val ...string) attribute.KeyValue { + return UserRolesKey.StringSlice(val) +} + +// Namespace: user_agent +const ( + // UserAgentNameKey is the attribute Key conforming to the "user_agent.name" + // semantic conventions. It represents the name of the user-agent extracted from + // original. Usually refers to the browser's name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Safari", "YourApp" + // Note: [Example] of extracting browser's name from original string. In the + // case of using a user-agent for non-browser products, such as microservices + // with multiple names/versions inside the `user_agent.original`, the most + // significant name SHOULD be selected. In such a scenario it should align with + // `user_agent.version` + // + // [Example]: https://www.whatsmyua.info + UserAgentNameKey = attribute.Key("user_agent.name") + + // UserAgentOriginalKey is the attribute Key conforming to the + // "user_agent.original" semantic conventions. It represents the value of the + // [HTTP User-Agent] header sent by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "CERN-LineMode/2.15 libwww/2.17b3", "Mozilla/5.0 (iPhone; CPU + // iPhone OS 14_7_1 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) + // Version/14.1.2 Mobile/15E148 Safari/604.1", "YourApp/1.0.0 + // grpc-java-okhttp/1.27.2" + // + // [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent + UserAgentOriginalKey = attribute.Key("user_agent.original") + + // UserAgentOSNameKey is the attribute Key conforming to the + // "user_agent.os.name" semantic conventions. It represents the human readable + // operating system name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iOS", "Android", "Ubuntu" + // Note: For mapping user agent strings to OS names, libraries such as + // [ua-parser] can be utilized. + // + // [ua-parser]: https://github.com/ua-parser + UserAgentOSNameKey = attribute.Key("user_agent.os.name") + + // UserAgentOSVersionKey is the attribute Key conforming to the + // "user_agent.os.version" semantic conventions. It represents the version + // string of the operating system as defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.2.1", "18.04.1" + // Note: For mapping user agent strings to OS versions, libraries such as + // [ua-parser] can be utilized. + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + // [ua-parser]: https://github.com/ua-parser + UserAgentOSVersionKey = attribute.Key("user_agent.os.version") + + // UserAgentSyntheticTypeKey is the attribute Key conforming to the + // "user_agent.synthetic.type" semantic conventions. It represents the specifies + // the category of synthetic traffic, such as tests or bots. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This attribute MAY be derived from the contents of the + // `user_agent.original` attribute. Components that populate the attribute are + // responsible for determining what they consider to be synthetic bot or test + // traffic. This attribute can either be set for self-identification purposes, + // or on telemetry detected to be generated as a result of a synthetic request. + // This attribute is useful for distinguishing between genuine client traffic + // and synthetic traffic generated by bots or tests. + UserAgentSyntheticTypeKey = attribute.Key("user_agent.synthetic.type") + + // UserAgentVersionKey is the attribute Key conforming to the + // "user_agent.version" semantic conventions. It represents the version of the + // user-agent extracted from original. Usually refers to the browser's version. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.1.2", "1.0.0" + // Note: [Example] of extracting browser's version from original string. In the + // case of using a user-agent for non-browser products, such as microservices + // with multiple names/versions inside the `user_agent.original`, the most + // significant version SHOULD be selected. In such a scenario it should align + // with `user_agent.name` + // + // [Example]: https://www.whatsmyua.info + UserAgentVersionKey = attribute.Key("user_agent.version") +) + +// UserAgentName returns an attribute KeyValue conforming to the +// "user_agent.name" semantic conventions. It represents the name of the +// user-agent extracted from original. Usually refers to the browser's name. +func UserAgentName(val string) attribute.KeyValue { + return UserAgentNameKey.String(val) +} + +// UserAgentOriginal returns an attribute KeyValue conforming to the +// "user_agent.original" semantic conventions. It represents the value of the +// [HTTP User-Agent] header sent by the client. +// +// [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent +func UserAgentOriginal(val string) attribute.KeyValue { + return UserAgentOriginalKey.String(val) +} + +// UserAgentOSName returns an attribute KeyValue conforming to the +// "user_agent.os.name" semantic conventions. It represents the human readable +// operating system name. +func UserAgentOSName(val string) attribute.KeyValue { + return UserAgentOSNameKey.String(val) +} + +// UserAgentOSVersion returns an attribute KeyValue conforming to the +// "user_agent.os.version" semantic conventions. It represents the version string +// of the operating system as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func UserAgentOSVersion(val string) attribute.KeyValue { + return UserAgentOSVersionKey.String(val) +} + +// UserAgentVersion returns an attribute KeyValue conforming to the +// "user_agent.version" semantic conventions. It represents the version of the +// user-agent extracted from original. Usually refers to the browser's version. +func UserAgentVersion(val string) attribute.KeyValue { + return UserAgentVersionKey.String(val) +} + +// Enum values for user_agent.synthetic.type +var ( + // Bot source. + // Stability: development + UserAgentSyntheticTypeBot = UserAgentSyntheticTypeKey.String("bot") + // Synthetic test source. + // Stability: development + UserAgentSyntheticTypeTest = UserAgentSyntheticTypeKey.String("test") +) + +// Namespace: vcs +const ( + // VCSChangeIDKey is the attribute Key conforming to the "vcs.change.id" + // semantic conventions. It represents the ID of the change (pull request/merge + // request/changelist) if applicable. This is usually a unique (within + // repository) identifier generated by the VCS system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123" + VCSChangeIDKey = attribute.Key("vcs.change.id") + + // VCSChangeStateKey is the attribute Key conforming to the "vcs.change.state" + // semantic conventions. It represents the state of the change (pull + // request/merge request/changelist). + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "open", "closed", "merged" + VCSChangeStateKey = attribute.Key("vcs.change.state") + + // VCSChangeTitleKey is the attribute Key conforming to the "vcs.change.title" + // semantic conventions. It represents the human readable title of the change + // (pull request/merge request/changelist). This title is often a brief summary + // of the change and may get merged in to a ref as the commit summary. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Fixes broken thing", "feat: add my new feature", "[chore] update + // dependency" + VCSChangeTitleKey = attribute.Key("vcs.change.title") + + // VCSLineChangeTypeKey is the attribute Key conforming to the + // "vcs.line_change.type" semantic conventions. It represents the type of line + // change being measured on a branch or change. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "added", "removed" + VCSLineChangeTypeKey = attribute.Key("vcs.line_change.type") + + // VCSOwnerNameKey is the attribute Key conforming to the "vcs.owner.name" + // semantic conventions. It represents the group owner within the version + // control system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-org", "myteam", "business-unit" + VCSOwnerNameKey = attribute.Key("vcs.owner.name") + + // VCSProviderNameKey is the attribute Key conforming to the "vcs.provider.name" + // semantic conventions. It represents the name of the version control system + // provider. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "github", "gitlab", "gitea", "bitbucket" + VCSProviderNameKey = attribute.Key("vcs.provider.name") + + // VCSRefBaseNameKey is the attribute Key conforming to the "vcs.ref.base.name" + // semantic conventions. It represents the name of the [reference] such as + // **branch** or **tag** in the repository. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-feature-branch", "tag-1-test" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefBaseNameKey = attribute.Key("vcs.ref.base.name") + + // VCSRefBaseRevisionKey is the attribute Key conforming to the + // "vcs.ref.base.revision" semantic conventions. It represents the revision, + // literally [revised version], The revision most often refers to a commit + // object in Git, or a revision number in SVN. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc", + // "main", "123", "HEAD" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. The + // revision can be a full [hash value (see + // glossary)], + // of the recorded change to a ref within a repository pointing to a + // commit [commit] object. It does + // not necessarily have to be a hash; it can simply define a [revision + // number] + // which is an integer that is monotonically increasing. In cases where + // it is identical to the `ref.base.name`, it SHOULD still be included. + // It is up to the implementer to decide which value to set as the + // revision based on the VCS system and situational context. + // + // [revised version]: https://www.merriam-webster.com/dictionary/revision + // [hash value (see + // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [commit]: https://git-scm.com/docs/git-commit + // [revision + // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html + VCSRefBaseRevisionKey = attribute.Key("vcs.ref.base.revision") + + // VCSRefBaseTypeKey is the attribute Key conforming to the "vcs.ref.base.type" + // semantic conventions. It represents the type of the [reference] in the + // repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefBaseTypeKey = attribute.Key("vcs.ref.base.type") + + // VCSRefHeadNameKey is the attribute Key conforming to the "vcs.ref.head.name" + // semantic conventions. It represents the name of the [reference] such as + // **branch** or **tag** in the repository. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-feature-branch", "tag-1-test" + // Note: `head` refers to where you are right now; the current reference at a + // given time. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefHeadNameKey = attribute.Key("vcs.ref.head.name") + + // VCSRefHeadRevisionKey is the attribute Key conforming to the + // "vcs.ref.head.revision" semantic conventions. It represents the revision, + // literally [revised version], The revision most often refers to a commit + // object in Git, or a revision number in SVN. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc", + // "main", "123", "HEAD" + // Note: `head` refers to where you are right now; the current reference at a + // given time.The revision can be a full [hash value (see + // glossary)], + // of the recorded change to a ref within a repository pointing to a + // commit [commit] object. It does + // not necessarily have to be a hash; it can simply define a [revision + // number] + // which is an integer that is monotonically increasing. In cases where + // it is identical to the `ref.head.name`, it SHOULD still be included. + // It is up to the implementer to decide which value to set as the + // revision based on the VCS system and situational context. + // + // [revised version]: https://www.merriam-webster.com/dictionary/revision + // [hash value (see + // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [commit]: https://git-scm.com/docs/git-commit + // [revision + // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html + VCSRefHeadRevisionKey = attribute.Key("vcs.ref.head.revision") + + // VCSRefHeadTypeKey is the attribute Key conforming to the "vcs.ref.head.type" + // semantic conventions. It represents the type of the [reference] in the + // repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // Note: `head` refers to where you are right now; the current reference at a + // given time. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefHeadTypeKey = attribute.Key("vcs.ref.head.type") + + // VCSRefTypeKey is the attribute Key conforming to the "vcs.ref.type" semantic + // conventions. It represents the type of the [reference] in the repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefTypeKey = attribute.Key("vcs.ref.type") + + // VCSRepositoryNameKey is the attribute Key conforming to the + // "vcs.repository.name" semantic conventions. It represents the human readable + // name of the repository. It SHOULD NOT include any additional identifier like + // Group/SubGroup in GitLab or organization in GitHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "semantic-conventions", "my-cool-repo" + // Note: Due to it only being the name, it can clash with forks of the same + // repository if collecting telemetry across multiple orgs or groups in + // the same backends. + VCSRepositoryNameKey = attribute.Key("vcs.repository.name") + + // VCSRepositoryURLFullKey is the attribute Key conforming to the + // "vcs.repository.url.full" semantic conventions. It represents the + // [canonical URL] of the repository providing the complete HTTP(S) address in + // order to locate and identify the repository through a browser. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/opentelemetry/open-telemetry-collector-contrib", + // "https://gitlab.com/my-org/my-project/my-projects-project/repo" + // Note: In Git Version Control Systems, the canonical URL SHOULD NOT include + // the `.git` extension. + // + // [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical. + VCSRepositoryURLFullKey = attribute.Key("vcs.repository.url.full") + + // VCSRevisionDeltaDirectionKey is the attribute Key conforming to the + // "vcs.revision_delta.direction" semantic conventions. It represents the type + // of revision comparison. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ahead", "behind" + VCSRevisionDeltaDirectionKey = attribute.Key("vcs.revision_delta.direction") +) + +// VCSChangeID returns an attribute KeyValue conforming to the "vcs.change.id" +// semantic conventions. It represents the ID of the change (pull request/merge +// request/changelist) if applicable. This is usually a unique (within +// repository) identifier generated by the VCS system. +func VCSChangeID(val string) attribute.KeyValue { + return VCSChangeIDKey.String(val) +} + +// VCSChangeTitle returns an attribute KeyValue conforming to the +// "vcs.change.title" semantic conventions. It represents the human readable +// title of the change (pull request/merge request/changelist). This title is +// often a brief summary of the change and may get merged in to a ref as the +// commit summary. +func VCSChangeTitle(val string) attribute.KeyValue { + return VCSChangeTitleKey.String(val) +} + +// VCSOwnerName returns an attribute KeyValue conforming to the "vcs.owner.name" +// semantic conventions. It represents the group owner within the version control +// system. +func VCSOwnerName(val string) attribute.KeyValue { + return VCSOwnerNameKey.String(val) +} + +// VCSRefBaseName returns an attribute KeyValue conforming to the +// "vcs.ref.base.name" semantic conventions. It represents the name of the +// [reference] such as **branch** or **tag** in the repository. +// +// [reference]: https://git-scm.com/docs/gitglossary#def_ref +func VCSRefBaseName(val string) attribute.KeyValue { + return VCSRefBaseNameKey.String(val) +} + +// VCSRefBaseRevision returns an attribute KeyValue conforming to the +// "vcs.ref.base.revision" semantic conventions. It represents the revision, +// literally [revised version], The revision most often refers to a commit object +// in Git, or a revision number in SVN. +// +// [revised version]: https://www.merriam-webster.com/dictionary/revision +func VCSRefBaseRevision(val string) attribute.KeyValue { + return VCSRefBaseRevisionKey.String(val) +} + +// VCSRefHeadName returns an attribute KeyValue conforming to the +// "vcs.ref.head.name" semantic conventions. It represents the name of the +// [reference] such as **branch** or **tag** in the repository. +// +// [reference]: https://git-scm.com/docs/gitglossary#def_ref +func VCSRefHeadName(val string) attribute.KeyValue { + return VCSRefHeadNameKey.String(val) +} + +// VCSRefHeadRevision returns an attribute KeyValue conforming to the +// "vcs.ref.head.revision" semantic conventions. It represents the revision, +// literally [revised version], The revision most often refers to a commit object +// in Git, or a revision number in SVN. +// +// [revised version]: https://www.merriam-webster.com/dictionary/revision +func VCSRefHeadRevision(val string) attribute.KeyValue { + return VCSRefHeadRevisionKey.String(val) +} + +// VCSRepositoryName returns an attribute KeyValue conforming to the +// "vcs.repository.name" semantic conventions. It represents the human readable +// name of the repository. It SHOULD NOT include any additional identifier like +// Group/SubGroup in GitLab or organization in GitHub. +func VCSRepositoryName(val string) attribute.KeyValue { + return VCSRepositoryNameKey.String(val) +} + +// VCSRepositoryURLFull returns an attribute KeyValue conforming to the +// "vcs.repository.url.full" semantic conventions. It represents the +// [canonical URL] of the repository providing the complete HTTP(S) address in +// order to locate and identify the repository through a browser. +// +// [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical. +func VCSRepositoryURLFull(val string) attribute.KeyValue { + return VCSRepositoryURLFullKey.String(val) +} + +// Enum values for vcs.change.state +var ( + // Open means the change is currently active and under review. It hasn't been + // merged into the target branch yet, and it's still possible to make changes or + // add comments. + // Stability: development + VCSChangeStateOpen = VCSChangeStateKey.String("open") + // WIP (work-in-progress, draft) means the change is still in progress and not + // yet ready for a full review. It might still undergo significant changes. + // Stability: development + VCSChangeStateWip = VCSChangeStateKey.String("wip") + // Closed means the merge request has been closed without merging. This can + // happen for various reasons, such as the changes being deemed unnecessary, the + // issue being resolved in another way, or the author deciding to withdraw the + // request. + // Stability: development + VCSChangeStateClosed = VCSChangeStateKey.String("closed") + // Merged indicates that the change has been successfully integrated into the + // target codebase. + // Stability: development + VCSChangeStateMerged = VCSChangeStateKey.String("merged") +) + +// Enum values for vcs.line_change.type +var ( + // How many lines were added. + // Stability: development + VCSLineChangeTypeAdded = VCSLineChangeTypeKey.String("added") + // How many lines were removed. + // Stability: development + VCSLineChangeTypeRemoved = VCSLineChangeTypeKey.String("removed") +) + +// Enum values for vcs.provider.name +var ( + // [GitHub] + // Stability: development + // + // [GitHub]: https://github.com + VCSProviderNameGithub = VCSProviderNameKey.String("github") + // [GitLab] + // Stability: development + // + // [GitLab]: https://gitlab.com + VCSProviderNameGitlab = VCSProviderNameKey.String("gitlab") + // Deprecated: Replaced by `gitea`. + VCSProviderNameGittea = VCSProviderNameKey.String("gittea") + // [Gitea] + // Stability: development + // + // [Gitea]: https://gitea.io + VCSProviderNameGitea = VCSProviderNameKey.String("gitea") + // [Bitbucket] + // Stability: development + // + // [Bitbucket]: https://bitbucket.org + VCSProviderNameBitbucket = VCSProviderNameKey.String("bitbucket") +) + +// Enum values for vcs.ref.base.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefBaseTypeBranch = VCSRefBaseTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefBaseTypeTag = VCSRefBaseTypeKey.String("tag") +) + +// Enum values for vcs.ref.head.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefHeadTypeBranch = VCSRefHeadTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefHeadTypeTag = VCSRefHeadTypeKey.String("tag") +) + +// Enum values for vcs.ref.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefTypeBranch = VCSRefTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefTypeTag = VCSRefTypeKey.String("tag") +) + +// Enum values for vcs.revision_delta.direction +var ( + // How many revisions the change is behind the target ref. + // Stability: development + VCSRevisionDeltaDirectionBehind = VCSRevisionDeltaDirectionKey.String("behind") + // How many revisions the change is ahead of the target ref. + // Stability: development + VCSRevisionDeltaDirectionAhead = VCSRevisionDeltaDirectionKey.String("ahead") +) + +// Namespace: webengine +const ( + // WebEngineDescriptionKey is the attribute Key conforming to the + // "webengine.description" semantic conventions. It represents the additional + // description of the web engine (e.g. detailed version and edition + // information). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "WildFly Full 21.0.0.Final (WildFly Core 13.0.1.Final) - + // 2.2.2.Final" + WebEngineDescriptionKey = attribute.Key("webengine.description") + + // WebEngineNameKey is the attribute Key conforming to the "webengine.name" + // semantic conventions. It represents the name of the web engine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "WildFly" + WebEngineNameKey = attribute.Key("webengine.name") + + // WebEngineVersionKey is the attribute Key conforming to the + // "webengine.version" semantic conventions. It represents the version of the + // web engine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "21.0.0" + WebEngineVersionKey = attribute.Key("webengine.version") +) + +// WebEngineDescription returns an attribute KeyValue conforming to the +// "webengine.description" semantic conventions. It represents the additional +// description of the web engine (e.g. detailed version and edition information). +func WebEngineDescription(val string) attribute.KeyValue { + return WebEngineDescriptionKey.String(val) +} + +// WebEngineName returns an attribute KeyValue conforming to the "webengine.name" +// semantic conventions. It represents the name of the web engine. +func WebEngineName(val string) attribute.KeyValue { + return WebEngineNameKey.String(val) +} + +// WebEngineVersion returns an attribute KeyValue conforming to the +// "webengine.version" semantic conventions. It represents the version of the web +// engine. +func WebEngineVersion(val string) attribute.KeyValue { + return WebEngineVersionKey.String(val) +} \ No newline at end of file diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go new file mode 100644 index 0000000000..2c5c7ebd04 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go @@ -0,0 +1,9 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +// Package semconv implements OpenTelemetry semantic conventions. +// +// OpenTelemetry semantic conventions are agreed standardized naming +// patterns for OpenTelemetry things. This package represents the v1.34.0 +// version of the OpenTelemetry semantic conventions. +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go new file mode 100644 index 0000000000..88a998f1e5 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go @@ -0,0 +1,9 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" + +const ( + // ExceptionEventName is the name of the Span event representing an exception. + ExceptionEventName = "exception" +) diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go new file mode 100644 index 0000000000..3c23d45925 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go @@ -0,0 +1,9 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" + +// SchemaURL is the schema URL that matches the version of the semantic conventions +// that this package defines. Semconv packages starting from v1.4.0 must declare +// non-empty schema URL in the form https://opentelemetry.io/schemas/ +const SchemaURL = "https://opentelemetry.io/schemas/1.34.0" diff --git a/vendor/go.opentelemetry.io/otel/trace/auto.go b/vendor/go.opentelemetry.io/otel/trace/auto.go index d90af8f673..f3aa398138 100644 --- a/vendor/go.opentelemetry.io/otel/trace/auto.go +++ b/vendor/go.opentelemetry.io/otel/trace/auto.go @@ -20,7 +20,7 @@ import ( "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" - semconv "go.opentelemetry.io/otel/semconv/v1.26.0" + semconv "go.opentelemetry.io/otel/semconv/v1.34.0" "go.opentelemetry.io/otel/trace/embedded" "go.opentelemetry.io/otel/trace/internal/telemetry" ) diff --git a/vendor/go.opentelemetry.io/otel/version.go b/vendor/go.opentelemetry.io/otel/version.go index ac3c0b15da..7afe92b598 100644 --- a/vendor/go.opentelemetry.io/otel/version.go +++ b/vendor/go.opentelemetry.io/otel/version.go @@ -5,5 +5,5 @@ package otel // import "go.opentelemetry.io/otel" // Version is the current release version of OpenTelemetry in use. func Version() string { - return "1.36.0" + return "1.37.0" } diff --git a/vendor/go.opentelemetry.io/otel/versions.yaml b/vendor/go.opentelemetry.io/otel/versions.yaml index 79f82f3d05..9d4742a176 100644 --- a/vendor/go.opentelemetry.io/otel/versions.yaml +++ b/vendor/go.opentelemetry.io/otel/versions.yaml @@ -3,13 +3,12 @@ module-sets: stable-v1: - version: v1.36.0 + version: v1.37.0 modules: - go.opentelemetry.io/otel - go.opentelemetry.io/otel/bridge/opencensus - go.opentelemetry.io/otel/bridge/opencensus/test - go.opentelemetry.io/otel/bridge/opentracing - - go.opentelemetry.io/otel/bridge/opentracing/test - go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc - go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp - go.opentelemetry.io/otel/exporters/otlp/otlptrace @@ -23,14 +22,16 @@ module-sets: - go.opentelemetry.io/otel/sdk/metric - go.opentelemetry.io/otel/trace experimental-metrics: - version: v0.58.0 + version: v0.59.0 modules: - go.opentelemetry.io/otel/exporters/prometheus experimental-logs: - version: v0.12.0 + version: v0.13.0 modules: - go.opentelemetry.io/otel/log + - go.opentelemetry.io/otel/log/logtest - go.opentelemetry.io/otel/sdk/log + - go.opentelemetry.io/otel/sdk/log/logtest - go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc - go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp - go.opentelemetry.io/otel/exporters/stdout/stdoutlog @@ -40,6 +41,4 @@ module-sets: - go.opentelemetry.io/otel/schema excluded-modules: - go.opentelemetry.io/otel/internal/tools - - go.opentelemetry.io/otel/log/logtest - - go.opentelemetry.io/otel/sdk/log/logtest - go.opentelemetry.io/otel/trace/internal/telemetry/test diff --git a/vendor/modernc.org/libc/asm_linux_amd64.go b/vendor/modernc.org/libc/asm_linux_amd64.go index d42d884669..9ad0e6e741 100644 --- a/vendor/modernc.org/libc/asm_linux_amd64.go +++ b/vendor/modernc.org/libc/asm_linux_amd64.go @@ -2,1319 +2,2635 @@ package libc +//go:noescape func Ya64l(tls *TLS, s uintptr) (r int64) +//go:noescape func Yabort(tls *TLS) +//go:noescape func Yabs(tls *TLS, a int32) (r int32) +//go:noescape func Yaccept(tls *TLS, fd int32, addr uintptr, len1 uintptr) (r1 int32) +//go:noescape func Yaccept4(tls *TLS, fd int32, addr uintptr, len1 uintptr, flg int32) (r1 int32) +//go:noescape func Yaccess(tls *TLS, filename uintptr, amode int32) (r int32) +//go:noescape func Yacct(tls *TLS, filename uintptr) (r int32) +//go:noescape func Yacos(tls *TLS, x float64) (r float64) +//go:noescape func Yacosf(tls *TLS, x float32) (r float32) +//go:noescape func Yacosh(tls *TLS, x float64) (r float64) +//go:noescape func Yacoshf(tls *TLS, x float32) (r float32) +//go:noescape func Yacoshl(tls *TLS, x float64) (r float64) +//go:noescape func Yacosl(tls *TLS, x float64) (r float64) +//go:noescape func Yaddmntent(tls *TLS, f uintptr, mnt uintptr) (r int32) +//go:noescape func Yadjtime(tls *TLS, in uintptr, out uintptr) (r int32) +//go:noescape func Yadjtimex(tls *TLS, tx uintptr) (r int32) +//go:noescape func Yalarm(tls *TLS, seconds uint32) (r uint32) +//go:noescape func Yalloca(tls *TLS, size Tsize_t) uintptr +//go:noescape func Yalphasort(tls *TLS, a uintptr, b uintptr) (r int32) +//go:noescape func Yarch_prctl(tls *TLS, code int32, addr uint64) (r int32) +//go:noescape func Yasctime(tls *TLS, tm uintptr) (r uintptr) +//go:noescape func Yasctime_r(tls *TLS, tm uintptr, buf uintptr) (r uintptr) +//go:noescape func Yasin(tls *TLS, x float64) (r1 float64) +//go:noescape func Yasinf(tls *TLS, x float32) (r float32) +//go:noescape func Yasinh(tls *TLS, x3 float64) (r float64) +//go:noescape func Yasinhf(tls *TLS, x3 float32) (r float32) +//go:noescape func Yasinhl(tls *TLS, x float64) (r float64) +//go:noescape func Yasinl(tls *TLS, x float64) (r float64) +//go:noescape func Yasprintf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Yat_quick_exit(tls *TLS, func1 uintptr) (r1 int32) +//go:noescape func Yatan(tls *TLS, x3 float64) (r float64) +//go:noescape func Yatan2(tls *TLS, y float64, x float64) (r float64) +//go:noescape func Yatan2f(tls *TLS, y float32, x float32) (r float32) +//go:noescape func Yatan2l(tls *TLS, y float64, x float64) (r float64) +//go:noescape func Yatanf(tls *TLS, x3 float32) (r float32) +//go:noescape func Yatanh(tls *TLS, x3 float64) (r float64) +//go:noescape func Yatanhf(tls *TLS, x3 float32) (r float32) +//go:noescape func Yatanhl(tls *TLS, x float64) (r float64) +//go:noescape func Yatanl(tls *TLS, x float64) (r float64) +//go:noescape func Yatexit(tls *TLS, func_ uintptr) (r int32) +//go:noescape func Yatof(tls *TLS, s uintptr) (r float64) +//go:noescape func Yatoi(tls *TLS, s uintptr) (r int32) +//go:noescape func Yatol(tls *TLS, s uintptr) (r int64) +//go:noescape func Yatoll(tls *TLS, s uintptr) (r int64) +//go:noescape func Ybacktrace(t *TLS, buf uintptr, size int32) int32 +//go:noescape func Ybacktrace_symbols_fd(t *TLS, buffer uintptr, size, fd int32) +//go:noescape func Ybasename(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Ybcmp(tls *TLS, s1 uintptr, s2 uintptr, n Tsize_t) (r int32) +//go:noescape func Ybcopy(tls *TLS, s1 uintptr, s2 uintptr, n Tsize_t) +//go:noescape func Ybind(tls *TLS, fd int32, addr uintptr, len1 Tsocklen_t) (r1 int32) +//go:noescape func Ybind_textdomain_codeset(tls *TLS, domainname uintptr, codeset uintptr) (r uintptr) +//go:noescape func Ybindtextdomain(tls *TLS, domainname uintptr, dirname uintptr) (r uintptr) +//go:noescape func Ybrk(tls *TLS, end uintptr) (r int32) +//go:noescape func Ybsearch(tls *TLS, key uintptr, base uintptr, nel Tsize_t, width Tsize_t, cmp uintptr) (r uintptr) +//go:noescape func Ybtowc(tls *TLS, c int32) (r Twint_t) +//go:noescape func Ybzero(tls *TLS, s uintptr, n Tsize_t) +//go:noescape func Yc16rtomb(tls *TLS, s uintptr, c16 Tchar16_t, ps uintptr) (r Tsize_t) +//go:noescape func Yc32rtomb(tls *TLS, s uintptr, c32 Tchar32_t, ps uintptr) (r Tsize_t) +//go:noescape func Ycabs(tls *TLS, z complex128) (r float64) +//go:noescape func Ycabsf(tls *TLS, z complex64) (r float32) +//go:noescape func Ycabsl(tls *TLS, z complex128) (r float64) +//go:noescape func Ycacos(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycacosf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycacosh(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycacoshf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycacoshl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycacosl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycalloc(tls *TLS, m Tsize_t, n Tsize_t) (r uintptr) +//go:noescape func Ycapget(tls *TLS, a uintptr, b uintptr) (r int32) +//go:noescape func Ycapset(tls *TLS, a uintptr, b uintptr) (r int32) +//go:noescape func Ycarg(tls *TLS, z complex128) (r float64) +//go:noescape func Ycargf(tls *TLS, z complex64) (r float32) +//go:noescape func Ycargl(tls *TLS, z complex128) (r float64) +//go:noescape func Ycasin(tls *TLS, z complex128) (r1 complex128) +//go:noescape func Ycasinf(tls *TLS, z complex64) (r1 complex64) +//go:noescape func Ycasinh(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycasinhf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycasinhl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycasinl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycatan(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycatanf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycatanh(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycatanhf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycatanhl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycatanl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycatclose(tls *TLS, catd Tnl_catd) (r int32) +//go:noescape func Ycatgets(tls *TLS, catd Tnl_catd, set_id int32, msg_id int32, s uintptr) (r uintptr) +//go:noescape func Ycatopen(tls *TLS, name uintptr, oflag int32) (r Tnl_catd) +//go:noescape func Ycbrt(tls *TLS, x float64) (r1 float64) +//go:noescape func Ycbrtf(tls *TLS, x float32) (r1 float32) +//go:noescape func Ycbrtl(tls *TLS, x float64) (r float64) +//go:noescape func Yccos(tls *TLS, z complex128) (r complex128) +//go:noescape func Yccosf(tls *TLS, z complex64) (r complex64) +//go:noescape func Yccosh(tls *TLS, z complex128) (r complex128) +//go:noescape func Yccoshf(tls *TLS, z complex64) (r complex64) +//go:noescape func Yccoshl(tls *TLS, z complex128) (r complex128) +//go:noescape func Yccosl(tls *TLS, z complex128) (r complex128) +//go:noescape func Yceil(tls *TLS, x3 float64) (r float64) +//go:noescape func Yceilf(tls *TLS, x3 float32) (r float32) +//go:noescape func Yceill(tls *TLS, x float64) (r float64) +//go:noescape func Ycexp(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycexpf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycexpl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycfgetispeed(tls *TLS, tio uintptr) (r Tspeed_t) +//go:noescape func Ycfgetospeed(tls *TLS, tio uintptr) (r Tspeed_t) +//go:noescape func Ycfmakeraw(tls *TLS, t uintptr) +//go:noescape func Ycfsetispeed(tls *TLS, tio uintptr, speed Tspeed_t) (r int32) +//go:noescape func Ycfsetospeed(tls *TLS, tio uintptr, speed Tspeed_t) (r int32) +//go:noescape func Ycfsetspeed(tls *TLS, tio uintptr, speed Tspeed_t) (r int32) +//go:noescape func Ychdir(tls *TLS, path uintptr) (r int32) +//go:noescape func Ychmod(tls *TLS, path uintptr, mode Tmode_t) (r int32) +//go:noescape func Ychown(tls *TLS, path uintptr, uid Tuid_t, gid Tgid_t) (r int32) +//go:noescape func Ychroot(tls *TLS, path uintptr) (r int32) +//go:noescape func Ycimag(tls *TLS, z complex128) (r float64) +//go:noescape func Ycimagf(tls *TLS, z complex64) (r float32) +//go:noescape func Ycimagl(tls *TLS, z complex128) (r float64) +//go:noescape func Yclearenv(tls *TLS) (r int32) +//go:noescape func Yclearerr(tls *TLS, f uintptr) +//go:noescape func Yclearerr_unlocked(tls *TLS, f uintptr) +//go:noescape func Yclock(tls *TLS) (r Tclock_t) +//go:noescape func Yclock_adjtime(tls *TLS, clock_id Tclockid_t, utx uintptr) (r1 int32) +//go:noescape func Yclock_getcpuclockid(tls *TLS, pid Tpid_t, clk uintptr) (r int32) +//go:noescape func Yclock_getres(tls *TLS, clk Tclockid_t, ts uintptr) (r int32) +//go:noescape func Yclock_gettime(tls *TLS, clk Tclockid_t, ts uintptr) (r int32) +//go:noescape func Yclock_nanosleep(tls *TLS, clk Tclockid_t, flags int32, req uintptr, rem uintptr) (r int32) +//go:noescape func Yclock_settime(tls *TLS, clk Tclockid_t, ts uintptr) (r int32) +//go:noescape func Yclog(tls *TLS, z complex128) (r1 complex128) +//go:noescape func Yclogf(tls *TLS, z complex64) (r1 complex64) +//go:noescape func Yclogl(tls *TLS, z complex128) (r complex128) +//go:noescape func Yclose(tls *TLS, fd int32) (r1 int32) +//go:noescape func Yclosedir(tls *TLS, dir uintptr) (r int32) +//go:noescape func Ycloselog(tls *TLS) +//go:noescape func Yconfstr(tls *TLS, name int32, buf uintptr, len1 Tsize_t) (r Tsize_t) +//go:noescape func Yconj(tls *TLS, z complex128) (r complex128) +//go:noescape func Yconjf(tls *TLS, z complex64) (r complex64) +//go:noescape func Yconjl(tls *TLS, z complex128) (r complex128) +//go:noescape func Yconnect(tls *TLS, fd int32, addr uintptr, len1 Tsocklen_t) (r1 int32) +//go:noescape func Ycopy_file_range(tls *TLS, fd_in int32, off_in uintptr, fd_out int32, off_out uintptr, len1 Tsize_t, flags uint32) (r Tssize_t) +//go:noescape func Ycopysign(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Ycopysignf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Ycopysignl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Ycos(tls *TLS, x3 float64) (r float64) +//go:noescape func Ycosf(tls *TLS, x3 float32) (r float32) +//go:noescape func Ycosh(tls *TLS, x3 float64) (r float64) +//go:noescape func Ycoshf(tls *TLS, x3 float32) (r float32) +//go:noescape func Ycoshl(tls *TLS, x float64) (r float64) +//go:noescape func Ycosl(tls *TLS, x float64) (r float64) +//go:noescape func Ycpow(tls *TLS, z complex128, c complex128) (r complex128) +//go:noescape func Ycpowf(tls *TLS, z complex64, c complex64) (r complex64) +//go:noescape func Ycpowl(tls *TLS, z complex128, c complex128) (r complex128) +//go:noescape func Ycproj(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycprojf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycprojl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycreal(tls *TLS, z complex128) (r float64) +//go:noescape func Ycrealf(tls *TLS, z complex64) (r float32) +//go:noescape func Ycreall(tls *TLS, z complex128) (r float64) +//go:noescape func Ycreat(tls *TLS, filename uintptr, mode Tmode_t) (r int32) +//go:noescape func Ycrypt(tls *TLS, key uintptr, salt uintptr) (r uintptr) +//go:noescape func Ycrypt_r(tls *TLS, key uintptr, salt uintptr, data uintptr) (r uintptr) +//go:noescape func Ycsin(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycsinf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycsinh(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycsinhf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycsinhl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycsinl(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycsqrt(tls *TLS, z complex128) (r complex128) +//go:noescape func Ycsqrtf(tls *TLS, z complex64) (r complex64) +//go:noescape func Ycsqrtl(tls *TLS, z complex128) (r complex128) +//go:noescape func Yctan(tls *TLS, z complex128) (r complex128) +//go:noescape func Yctanf(tls *TLS, z complex64) (r complex64) +//go:noescape func Yctanh(tls *TLS, z complex128) (r complex128) +//go:noescape func Yctanhf(tls *TLS, z complex64) (r complex64) +//go:noescape func Yctanhl(tls *TLS, z complex128) (r complex128) +//go:noescape func Yctanl(tls *TLS, z complex128) (r complex128) +//go:noescape func Yctermid(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Yctime(tls *TLS, t uintptr) (r uintptr) +//go:noescape func Yctime_r(tls *TLS, t uintptr, buf uintptr) (r uintptr) +//go:noescape func Ycuserid(tls *TLS, buf uintptr) (r uintptr) +//go:noescape func Ydcgettext(tls *TLS, domainname uintptr, msgid uintptr, category int32) (r uintptr) +//go:noescape func Ydcngettext(tls *TLS, domainname uintptr, msgid1 uintptr, msgid2 uintptr, n uint64, category int32) (r1 uintptr) +//go:noescape func Ydelete_module(tls *TLS, a uintptr, b uint32) (r int32) +//go:noescape func Ydgettext(tls *TLS, domainname uintptr, msgid uintptr) (r uintptr) +//go:noescape func Ydifftime(tls *TLS, t1 Ttime_t, t0 Ttime_t) (r float64) +//go:noescape func Ydirfd(tls *TLS, d uintptr) (r int32) +//go:noescape func Ydirname(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Ydiv(tls *TLS, num int32, den int32) (r Tdiv_t) +//go:noescape func Ydlclose(t *TLS, handle uintptr) int32 +//go:noescape func Ydlerror(t *TLS) uintptr +//go:noescape func Ydlopen(t *TLS, filename uintptr, flags int32) uintptr +//go:noescape func Ydlsym(t *TLS, handle, symbol uintptr) uintptr +//go:noescape func Ydn_comp(tls *TLS, src uintptr, dst uintptr, space int32, dnptrs uintptr, lastdnptr uintptr) (r int32) +//go:noescape func Ydn_expand(tls *TLS, base uintptr, end uintptr, src uintptr, dest uintptr, space int32) (r int32) +//go:noescape func Ydn_skipname(tls *TLS, s uintptr, end uintptr) (r int32) +//go:noescape func Ydngettext(tls *TLS, domainname uintptr, msgid1 uintptr, msgid2 uintptr, n uint64) (r uintptr) +//go:noescape func Ydprintf(tls *TLS, fd int32, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ydrand48(tls *TLS) (r float64) +//go:noescape func Ydrem(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Ydremf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Ydup(tls *TLS, fd int32) (r int32) +//go:noescape func Ydup2(tls *TLS, old int32, new1 int32) (r1 int32) +//go:noescape func Ydup3(tls *TLS, old int32, new1 int32, flags int32) (r int32) +//go:noescape func Yduplocale(tls *TLS, old Tlocale_t) (r Tlocale_t) +//go:noescape func Yeaccess(tls *TLS, filename uintptr, amode int32) (r int32) +//go:noescape func Yecvt(tls *TLS, x float64, n int32, dp uintptr, sign uintptr) (r uintptr) +//go:noescape func Yencrypt(tls *TLS, block uintptr, edflag int32) +//go:noescape func Yendgrent(tls *TLS) +//go:noescape func Yendhostent(tls *TLS) +//go:noescape func Yendmntent(tls *TLS, f uintptr) (r int32) +//go:noescape func Yendnetent(tls *TLS) +//go:noescape func Yendprotoent(tls *TLS) +//go:noescape func Yendpwent(tls *TLS) +//go:noescape func Yendservent(tls *TLS) +//go:noescape func Yendspent(tls *TLS) +//go:noescape func Yendusershell(tls *TLS) +//go:noescape func Yendutent(tls *TLS) +//go:noescape func Yendutxent(tls *TLS) +//go:noescape func Yepoll_create(tls *TLS, size int32) (r int32) +//go:noescape func Yepoll_create1(tls *TLS, flags int32) (r1 int32) +//go:noescape func Yepoll_ctl(tls *TLS, fd int32, op int32, fd2 int32, ev uintptr) (r int32) +//go:noescape func Yepoll_pwait(tls *TLS, fd int32, ev uintptr, cnt int32, to int32, sigs uintptr) (r1 int32) +//go:noescape func Yepoll_wait(tls *TLS, fd int32, ev uintptr, cnt int32, to int32) (r int32) +//go:noescape func Yerand48(tls *TLS, s uintptr) (r float64) +//go:noescape func Yerf(tls *TLS, x float64) (r1 float64) +//go:noescape func Yerfc(tls *TLS, x float64) (r1 float64) +//go:noescape func Yerfcf(tls *TLS, x float32) (r1 float32) +//go:noescape func Yerfcl(tls *TLS, x float64) (r float64) +//go:noescape func Yerff(tls *TLS, x float32) (r1 float32) +//go:noescape func Yerfl(tls *TLS, x float64) (r float64) +//go:noescape func Yerr(tls *TLS, status int32, fmt uintptr, va uintptr) +//go:noescape func Yerrx(tls *TLS, status int32, fmt uintptr, va uintptr) +//go:noescape func Yether_aton(tls *TLS, x uintptr) (r uintptr) +//go:noescape func Yether_aton_r(tls *TLS, x uintptr, p_a uintptr) (r uintptr) +//go:noescape func Yether_hostton(tls *TLS, hostname uintptr, e uintptr) (r int32) +//go:noescape func Yether_line(tls *TLS, l uintptr, e uintptr, hostname uintptr) (r int32) +//go:noescape func Yether_ntoa(tls *TLS, p_a uintptr) (r uintptr) +//go:noescape func Yether_ntoa_r(tls *TLS, p_a uintptr, x uintptr) (r uintptr) +//go:noescape func Yether_ntohost(tls *TLS, hostname uintptr, e uintptr) (r int32) +//go:noescape func Yeuidaccess(tls *TLS, filename uintptr, amode int32) (r int32) +//go:noescape func Yeventfd(tls *TLS, count uint32, flags int32) (r1 int32) +//go:noescape func Yeventfd_read(tls *TLS, fd int32, value uintptr) (r int32) +//go:noescape func Yeventfd_write(tls *TLS, fd int32, _value Teventfd_t) (r int32) +//go:noescape func Yexecl(tls *TLS, path uintptr, argv0 uintptr, va uintptr) (r int32) +//go:noescape func Yexecle(tls *TLS, path uintptr, argv0 uintptr, va uintptr) (r int32) +//go:noescape func Yexeclp(tls *TLS, file uintptr, argv0 uintptr, va uintptr) (r int32) +//go:noescape func Yexecv(tls *TLS, path uintptr, argv uintptr) (r int32) +//go:noescape func Yexecve(tls *TLS, path uintptr, argv uintptr, envp uintptr) (r int32) +//go:noescape func Yexecvp(tls *TLS, file uintptr, argv uintptr) (r int32) +//go:noescape func Yexecvpe(tls *TLS, file uintptr, argv uintptr, envp uintptr) (r int32) +//go:noescape func Yexit(tls *TLS, code int32) +//go:noescape func Yexp(tls *TLS, x1 float64) (r1 float64) +//go:noescape func Yexp10(tls *TLS, x float64) (r float64) +//go:noescape func Yexp10f(tls *TLS, x float32) (r float32) +//go:noescape func Yexp10l(tls *TLS, x float64) (r float64) +//go:noescape func Yexp2(tls *TLS, x1 float64) (r1 float64) +//go:noescape func Yexp2f(tls *TLS, x2 float32) (r1 float32) +//go:noescape func Yexp2l(tls *TLS, x float64) (r float64) +//go:noescape func Yexpf(tls *TLS, x2 float32) (r1 float32) +//go:noescape func Yexpl(tls *TLS, x float64) (r float64) +//go:noescape func Yexplicit_bzero(tls *TLS, d uintptr, n Tsize_t) +//go:noescape func Yexpm1(tls *TLS, x3 float64) (r float64) +//go:noescape func Yexpm1f(tls *TLS, x3 float32) (r float32) +//go:noescape func Yexpm1l(tls *TLS, x float64) (r float64) +//go:noescape func Yfabs(tls *TLS, x float64) (r float64) +//go:noescape func Yfabsf(tls *TLS, x float32) (r float32) +//go:noescape func Yfabsl(tls *TLS, x float64) (r float64) +//go:noescape func Yfaccessat(tls *TLS, fd int32, filename uintptr, amode int32, flag int32) (r int32) +//go:noescape func Yfallocate(tls *TLS, fd int32, mode int32, base Toff_t, len1 Toff_t) (r int32) +//go:noescape func Yfanotify_init(tls *TLS, flags uint32, event_f_flags uint32) (r int32) +//go:noescape func Yfanotify_mark(tls *TLS, fanotify_fd int32, flags uint32, mask uint64, dfd int32, pathname uintptr) (r int32) +//go:noescape func Yfchdir(tls *TLS, fd int32) (r int32) +//go:noescape func Yfchmod(tls *TLS, fd int32, mode Tmode_t) (r int32) +//go:noescape func Yfchmodat(tls *TLS, fd int32, path uintptr, mode Tmode_t, flag int32) (r int32) +//go:noescape func Yfchown(tls *TLS, fd int32, uid Tuid_t, gid Tgid_t) (r int32) +//go:noescape func Yfchownat(tls *TLS, fd int32, path uintptr, uid Tuid_t, gid Tgid_t, flag int32) (r int32) +//go:noescape func Yfclose(tls *TLS, f uintptr) (r1 int32) +//go:noescape func Yfcntl(tls *TLS, fd int32, cmd int32, va uintptr) (r int32) +//go:noescape func Yfcntl64(tls *TLS, fd int32, cmd int32, va uintptr) (r int32) +//go:noescape func Yfcvt(tls *TLS, x float64, n int32, dp uintptr, sign uintptr) (r uintptr) +//go:noescape func Yfdatasync(tls *TLS, fd int32) (r int32) +//go:noescape func Yfdim(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfdimf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Yfdiml(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfdopen(tls *TLS, fd int32, mode uintptr) (r uintptr) +//go:noescape func Yfdopendir(tls *TLS, fd int32) (r uintptr) +//go:noescape func Yfeclearexcept(tls *TLS, mask int32) (r int32) +//go:noescape func Yfegetenv(tls *TLS, envp uintptr) (r int32) +//go:noescape func Yfegetround(tls *TLS) (r int32) +//go:noescape func Yfeof(tls *TLS, f uintptr) (r int32) +//go:noescape func Yfeof_unlocked(tls *TLS, f uintptr) (r int32) +//go:noescape func Yferaiseexcept(tls *TLS, mask int32) (r int32) +//go:noescape func Yferror(tls *TLS, f uintptr) (r int32) +//go:noescape func Yferror_unlocked(tls *TLS, f uintptr) (r int32) +//go:noescape func Yfesetenv(tls *TLS, envp uintptr) (r int32) +//go:noescape func Yfetestexcept(tls *TLS, mask int32) (r int32) +//go:noescape func Yfexecve(tls *TLS, fd int32, argv uintptr, envp uintptr) (r1 int32) +//go:noescape func Yfflush(tls *TLS, f uintptr) (r1 int32) +//go:noescape func Yfflush_unlocked(tls *TLS, f uintptr) (r int32) +//go:noescape func Yffs(tls *TLS, i int32) (r int32) +//go:noescape func Yffsl(tls *TLS, i int64) (r int32) +//go:noescape func Yffsll(tls *TLS, i int64) (r int32) +//go:noescape func Yfgetc(tls *TLS, f1 uintptr) (r int32) +//go:noescape func Yfgetc_unlocked(tls *TLS, f uintptr) (r int32) +//go:noescape func Yfgetgrent(tls *TLS, f uintptr) (r uintptr) +//go:noescape func Yfgetln(tls *TLS, f uintptr, plen uintptr) (r uintptr) +//go:noescape func Yfgetpos(tls *TLS, f uintptr, pos uintptr) (r int32) +//go:noescape func Yfgetpwent(tls *TLS, f uintptr) (r uintptr) +//go:noescape func Yfgets(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) +//go:noescape func Yfgets_unlocked(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) +//go:noescape func Yfgetwc(tls *TLS, f uintptr) (r Twint_t) +//go:noescape func Yfgetwc_unlocked(tls *TLS, f uintptr) (r Twint_t) +//go:noescape func Yfgetws(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) +//go:noescape func Yfgetws_unlocked(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) +//go:noescape func Yfgetxattr(tls *TLS, filedes int32, name uintptr, value uintptr, size Tsize_t) (r Tssize_t) +//go:noescape func Yfileno(tls *TLS, f uintptr) (r int32) +//go:noescape func Yfileno_unlocked(tls *TLS, f uintptr) (r int32) +//go:noescape func Yfinite(tls *TLS, x float64) (r int32) +//go:noescape func Yfinitef(tls *TLS, x float32) (r int32) +//go:noescape func Yflistxattr(tls *TLS, filedes int32, list uintptr, size Tsize_t) (r Tssize_t) +//go:noescape func Yflock(tls *TLS, fd int32, op int32) (r int32) +//go:noescape func Yflockfile(tls *TLS, f uintptr) +//go:noescape func Yfloor(tls *TLS, x3 float64) (r float64) +//go:noescape func Yfloorf(tls *TLS, x3 float32) (r float32) +//go:noescape func Yfloorl(tls *TLS, x float64) (r float64) +//go:noescape func Yfma(tls *TLS, x1 float64, y float64, z float64) (r1 float64) +//go:noescape func Yfmal(tls *TLS, x float64, y float64, z float64) (r float64) +//go:noescape func Yfmax(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfmaxf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Yfmaxl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfmemopen(tls *TLS, buf uintptr, size Tsize_t, mode uintptr) (r uintptr) +//go:noescape func Yfmin(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfminf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Yfminl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfmod(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfmodf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Yfmodl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yfmtmsg(tls *TLS, classification int64, label uintptr, severity int32, text uintptr, action uintptr, tag uintptr) (r int32) +//go:noescape func Yfnmatch(tls *TLS, pat uintptr, str uintptr, flags int32) (r int32) +//go:noescape func Yfopen(tls *TLS, filename uintptr, mode uintptr) (r uintptr) +//go:noescape func Yfopen64(tls *TLS, filename uintptr, mode uintptr) (r uintptr) +//go:noescape func Yfopencookie(tls *TLS, cookie uintptr, mode uintptr, iofuncs Tcookie_io_functions_t) (r uintptr) +//go:noescape func Yfork(t *TLS) int32 +//go:noescape func Yfpathconf(tls *TLS, fd int32, name int32) (r int64) +//go:noescape func Yfprintf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Yfpurge(tls *TLS, f uintptr) (r int32) +//go:noescape func Yfputc(tls *TLS, c1 int32, f1 uintptr) (r int32) +//go:noescape func Yfputc_unlocked(tls *TLS, c int32, f uintptr) (r int32) +//go:noescape func Yfputs(tls *TLS, s uintptr, f uintptr) (r int32) +//go:noescape func Yfputs_unlocked(tls *TLS, s uintptr, f uintptr) (r int32) +//go:noescape func Yfputwc(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) +//go:noescape func Yfputwc_unlocked(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) +//go:noescape func Yfputws(tls *TLS, _ws uintptr, f uintptr) (r int32) +//go:noescape func Yfputws_unlocked(tls *TLS, _ws uintptr, f uintptr) (r int32) +//go:noescape func Yfread(tls *TLS, destv uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) +//go:noescape func Yfread_unlocked(tls *TLS, destv uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) +//go:noescape func Yfree(tls *TLS, p uintptr) +//go:noescape func Yfreeaddrinfo(tls *TLS, p uintptr) +//go:noescape func Yfreeifaddrs(tls *TLS, ifp uintptr) +//go:noescape func Yfreelocale(tls *TLS, l Tlocale_t) +//go:noescape func Yfremovexattr(tls *TLS, fd int32, name uintptr) (r int32) +//go:noescape func Yfreopen(tls *TLS, filename uintptr, mode uintptr, f uintptr) (r uintptr) +//go:noescape func Yfrexp(tls *TLS, x float64, e uintptr) (r float64) +//go:noescape func Yfrexpf(tls *TLS, x float32, e uintptr) (r float32) +//go:noescape func Yfrexpl(tls *TLS, x float64, e uintptr) (r float64) +//go:noescape func Yfscanf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Yfseek(tls *TLS, f uintptr, off int64, whence int32) (r int32) +//go:noescape func Yfseeko(tls *TLS, f uintptr, off Toff_t, whence int32) (r int32) +//go:noescape func Yfsetpos(tls *TLS, f uintptr, pos uintptr) (r int32) +//go:noescape func Yfsetxattr(tls *TLS, filedes int32, name uintptr, value uintptr, size Tsize_t, flags int32) (r int32) +//go:noescape func Yfstat(tls *TLS, fd int32, st uintptr) (r int32) +//go:noescape func Yfstat64(tls *TLS, fd int32, st uintptr) (r int32) +//go:noescape func Yfstatat(tls *TLS, fd int32, path uintptr, st uintptr, flag int32) (r int32) +//go:noescape func Yfstatfs(tls *TLS, fd int32, buf uintptr) (r int32) +//go:noescape func Yfstatvfs(tls *TLS, fd int32, buf uintptr) (r int32) +//go:noescape func Yfsync(tls *TLS, fd int32) (r int32) +//go:noescape func Yftell(tls *TLS, f uintptr) (r int64) +//go:noescape func Yftello(tls *TLS, f uintptr) (r Toff_t) +//go:noescape func Yftime(tls *TLS, tp uintptr) (r int32) +//go:noescape func Yftok(tls *TLS, path uintptr, id int32) (r Tkey_t) +//go:noescape func Yftruncate(tls *TLS, fd int32, length Toff_t) (r int32) +//go:noescape func Yftruncate64(tls *TLS, fd int32, length Toff_t) (r int32) +//go:noescape func Yftrylockfile(tls *TLS, f uintptr) (r int32) +//go:noescape func Yfts64_close(t *TLS, ftsp uintptr) int32 +//go:noescape func Yfts64_open(t *TLS, path_argv uintptr, options int32, compar uintptr) uintptr +//go:noescape func Yfts64_read(t *TLS, ftsp uintptr) uintptr +//go:noescape func Yfts_close(t *TLS, ftsp uintptr) int32 +//go:noescape func Yfts_open(t *TLS, path_argv uintptr, options int32, compar uintptr) uintptr +//go:noescape func Yfts_read(t *TLS, ftsp uintptr) uintptr +//go:noescape func Yftw(tls *TLS, path uintptr, fn uintptr, fd_limit int32) (r int32) +//go:noescape func Yfunlockfile(tls *TLS, f uintptr) +//go:noescape func Yfutimens(tls *TLS, fd int32, times uintptr) (r int32) +//go:noescape func Yfutimes(tls *TLS, fd int32, tv uintptr) (r int32) +//go:noescape func Yfutimesat(tls *TLS, dirfd int32, pathname uintptr, times uintptr) (r int32) +//go:noescape func Yfwide(tls *TLS, f uintptr, mode int32) (r int32) +//go:noescape func Yfwprintf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Yfwrite(tls *TLS, src uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) +//go:noescape func Yfwrite_unlocked(tls *TLS, src uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) +//go:noescape func Yfwscanf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ygai_strerror(tls *TLS, ecode int32) (r uintptr) +//go:noescape func Ygcvt(tls *TLS, x float64, n int32, b uintptr) (r uintptr) +//go:noescape func Yget_avphys_pages(tls *TLS) (r int64) +//go:noescape func Yget_current_dir_name(tls *TLS) (r uintptr) +//go:noescape func Yget_nprocs(tls *TLS) (r int32) +//go:noescape func Yget_nprocs_conf(tls *TLS) (r int32) +//go:noescape func Yget_phys_pages(tls *TLS) (r int64) +//go:noescape func Ygetaddrinfo(tls *TLS, host uintptr, serv uintptr, hint uintptr, res uintptr) (r1 int32) +//go:noescape func Ygetauxval(tls *TLS, item uint64) (r uint64) +//go:noescape func Ygetc(tls *TLS, f1 uintptr) (r int32) +//go:noescape func Ygetc_unlocked(tls *TLS, f uintptr) (r int32) +//go:noescape func Ygetchar(tls *TLS) (r int32) +//go:noescape func Ygetchar_unlocked(tls *TLS) (r int32) +//go:noescape func Ygetcwd(tls *TLS, buf uintptr, size Tsize_t) (r uintptr) +//go:noescape func Ygetdate(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Ygetdelim(tls *TLS, s uintptr, n uintptr, delim int32, f uintptr) (r Tssize_t) +//go:noescape func Ygetdents(tls *TLS, fd int32, buf uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ygetdomainname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ygetdtablesize(tls *TLS) (r int32) +//go:noescape func Ygetegid(tls *TLS) (r Tgid_t) +//go:noescape func Ygetentropy(tls *TLS, buffer uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ygetenv(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Ygeteuid(tls *TLS) (r Tuid_t) +//go:noescape func Ygetgid(tls *TLS) (r Tgid_t) +//go:noescape func Ygetgrent(tls *TLS) (r uintptr) +//go:noescape func Ygetgrgid(tls *TLS, gid Tgid_t) (r uintptr) +//go:noescape func Ygetgrgid_r(tls *TLS, gid Tgid_t, gr uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) +//go:noescape func Ygetgrnam(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Ygetgrnam_r(tls *TLS, name uintptr, gr uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) +//go:noescape func Ygetgrouplist(tls *TLS, user uintptr, gid Tgid_t, groups uintptr, ngroups uintptr) (r int32) +//go:noescape func Ygetgroups(tls *TLS, count int32, list uintptr) (r int32) +//go:noescape func Ygethostbyaddr(tls *TLS, a uintptr, l Tsocklen_t, af int32) (r uintptr) +//go:noescape func Ygethostbyaddr_r(tls *TLS, a uintptr, l Tsocklen_t, af int32, h uintptr, buf uintptr, buflen Tsize_t, res uintptr, err uintptr) (r int32) +//go:noescape func Ygethostbyname(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Ygethostbyname2(tls *TLS, name uintptr, af int32) (r uintptr) +//go:noescape func Ygethostbyname2_r(tls *TLS, name uintptr, af int32, h uintptr, buf uintptr, buflen Tsize_t, res uintptr, err uintptr) (r int32) +//go:noescape func Ygethostbyname_r(tls *TLS, name uintptr, h uintptr, buf uintptr, buflen Tsize_t, res uintptr, err uintptr) (r int32) +//go:noescape func Ygethostent(tls *TLS) (r uintptr) +//go:noescape func Ygethostid(tls *TLS) (r int64) +//go:noescape func Ygethostname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ygetifaddrs(tls *TLS, ifap uintptr) (r1 int32) +//go:noescape func Ygetitimer(tls *TLS, which int32, old uintptr) (r1 int32) +//go:noescape func Ygetline(tls *TLS, s uintptr, n uintptr, f uintptr) (r Tssize_t) +//go:noescape func Ygetloadavg(tls *TLS, a uintptr, n int32) (r int32) +//go:noescape func Ygetlogin(tls *TLS) (r uintptr) +//go:noescape func Ygetlogin_r(tls *TLS, name uintptr, size Tsize_t) (r int32) +//go:noescape func Ygetmntent(tls *TLS, f uintptr) (r uintptr) +//go:noescape func Ygetmntent_r(tls *TLS, f uintptr, mnt uintptr, linebuf uintptr, buflen int32) (r uintptr) +//go:noescape func Ygetnameinfo(tls *TLS, sa uintptr, sl Tsocklen_t, node uintptr, nodelen Tsocklen_t, serv uintptr, servlen Tsocklen_t, flags int32) (r int32) +//go:noescape func Ygetnetbyaddr(tls *TLS, net Tuint32_t, type1 int32) (r uintptr) +//go:noescape func Ygetnetbyname(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Ygetnetent(tls *TLS) (r uintptr) +//go:noescape func Ygetopt(tls *TLS, argc int32, argv uintptr, optstring uintptr) (r int32) +//go:noescape func Ygetopt_long(tls *TLS, argc int32, argv uintptr, optstring uintptr, longopts uintptr, idx uintptr) (r int32) +//go:noescape func Ygetopt_long_only(tls *TLS, argc int32, argv uintptr, optstring uintptr, longopts uintptr, idx uintptr) (r int32) +//go:noescape func Ygetpagesize(tls *TLS) (r int32) +//go:noescape func Ygetpass(tls *TLS, prompt uintptr) (r uintptr) +//go:noescape func Ygetpeername(tls *TLS, fd int32, addr uintptr, len1 uintptr) (r1 int32) +//go:noescape func Ygetpgid(tls *TLS, pid Tpid_t) (r Tpid_t) +//go:noescape func Ygetpgrp(tls *TLS) (r Tpid_t) +//go:noescape func Ygetpid(tls *TLS) (r Tpid_t) +//go:noescape func Ygetppid(tls *TLS) (r Tpid_t) +//go:noescape func Ygetpriority(tls *TLS, which int32, who Tid_t) (r int32) +//go:noescape func Ygetprotobyname(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Ygetprotobynumber(tls *TLS, num int32) (r uintptr) +//go:noescape func Ygetprotoent(tls *TLS) (r uintptr) +//go:noescape func Ygetpwent(tls *TLS) (r uintptr) +//go:noescape func Ygetpwnam(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Ygetpwnam_r(tls *TLS, name uintptr, pw uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) +//go:noescape func Ygetpwuid(tls *TLS, uid Tuid_t) (r uintptr) +//go:noescape func Ygetpwuid_r(tls *TLS, uid Tuid_t, pw uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) +//go:noescape func Ygetrandom(tls *TLS, buf uintptr, buflen Tsize_t, flags uint32) (r Tssize_t) +//go:noescape func Ygetresgid(tls *TLS, rgid uintptr, egid uintptr, sgid uintptr) (r int32) +//go:noescape func Ygetresuid(tls *TLS, ruid uintptr, euid uintptr, suid uintptr) (r int32) +//go:noescape func Ygetrlimit(tls *TLS, resource int32, rlim uintptr) (r int32) +//go:noescape func Ygetrlimit64(tls *TLS, resource int32, rlim uintptr) (r int32) +//go:noescape func Ygetrusage(tls *TLS, who int32, ru uintptr) (r1 int32) +//go:noescape func Ygets(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Ygetservbyname(tls *TLS, name uintptr, prots uintptr) (r uintptr) +//go:noescape func Ygetservbyname_r(tls *TLS, name uintptr, prots uintptr, se uintptr, buf uintptr, buflen Tsize_t, res uintptr) (r int32) +//go:noescape func Ygetservent(tls *TLS) (r uintptr) +//go:noescape func Ygetsid(tls *TLS, pid Tpid_t) (r Tpid_t) +//go:noescape func Ygetsockname(tls *TLS, fd int32, addr uintptr, len1 uintptr) (r1 int32) +//go:noescape func Ygetsockopt(tls *TLS, fd int32, level int32, optname int32, optval uintptr, optlen uintptr) (r2 int32) +//go:noescape func Ygetspent(tls *TLS) (r uintptr) +//go:noescape func Ygetsubopt(tls *TLS, opt uintptr, keys uintptr, val uintptr) (r int32) +//go:noescape func Ygettext(tls *TLS, msgid uintptr) (r uintptr) +//go:noescape func Ygettimeofday(tls *TLS, tv uintptr, tz uintptr) (r int32) +//go:noescape func Ygetuid(tls *TLS) (r Tuid_t) +//go:noescape func Ygetusershell(tls *TLS) (r uintptr) +//go:noescape func Ygetutent(tls *TLS) (r uintptr) +//go:noescape func Ygetutid(tls *TLS, ut uintptr) (r uintptr) +//go:noescape func Ygetutline(tls *TLS, ut uintptr) (r uintptr) +//go:noescape func Ygetutxent(tls *TLS) (r uintptr) +//go:noescape func Ygetutxid(tls *TLS, ut uintptr) (r uintptr) +//go:noescape func Ygetutxline(tls *TLS, ut uintptr) (r uintptr) +//go:noescape func Ygetw(tls *TLS, f uintptr) (r int32) +//go:noescape func Ygetwc(tls *TLS, f uintptr) (r Twint_t) +//go:noescape func Ygetwc_unlocked(tls *TLS, f uintptr) (r Twint_t) +//go:noescape func Ygetwchar(tls *TLS) (r Twint_t) +//go:noescape func Ygetwchar_unlocked(tls *TLS) (r Twint_t) +//go:noescape func Ygetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t) (r Tssize_t) +//go:noescape func Yglob(tls *TLS, pat uintptr, flags int32, errfunc uintptr, g_ uintptr) (r int32) +//go:noescape func Yglobfree(tls *TLS, g_ uintptr) +//go:noescape func Ygmtime(tls *TLS, t uintptr) (r uintptr) +//go:noescape func Ygmtime_r(tls *TLS, t uintptr, tm uintptr) (r uintptr) +//go:noescape func Ygrantpt(tls *TLS, fd int32) (r int32) +//go:noescape func Yhasmntopt(tls *TLS, mnt uintptr, opt uintptr) (r uintptr) +//go:noescape func Yhcreate(tls *TLS, nel Tsize_t) (r int32) +//go:noescape func Yhdestroy(tls *TLS) +//go:noescape func Yherror(tls *TLS, msg uintptr) +//go:noescape func Yhsearch(tls *TLS, item TENTRY, action TACTION) (r uintptr) +//go:noescape func Yhstrerror(tls *TLS, ecode int32) (r uintptr) +//go:noescape func Yhtonl(tls *TLS, n Tuint32_t) (r Tuint32_t) +//go:noescape func Yhtons(tls *TLS, n Tuint16_t) (r Tuint16_t) +//go:noescape func Yhypot(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yhypotf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Yhypotl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yiconv(tls *TLS, cd Ticonv_t, in uintptr, inb uintptr, out uintptr, outb uintptr) (r Tsize_t) +//go:noescape func Yiconv_close(tls *TLS, cd Ticonv_t) (r int32) +//go:noescape func Yiconv_open(tls *TLS, to uintptr, from uintptr) (r Ticonv_t) +//go:noescape func Yif_freenameindex(tls *TLS, idx uintptr) +//go:noescape func Yif_indextoname(tls *TLS, index uint32, name uintptr) (r1 uintptr) +//go:noescape func Yif_nameindex(tls *TLS) (r uintptr) +//go:noescape func Yif_nametoindex(tls *TLS, name uintptr) (r1 uint32) +//go:noescape func Yilogb(tls *TLS, x3 float64) (r int32) +//go:noescape func Yilogbf(tls *TLS, x3 float32) (r int32) +//go:noescape func Yilogbl(tls *TLS, x float64) (r int32) +//go:noescape func Yimaxabs(tls *TLS, a Tintmax_t) (r Tintmax_t) +//go:noescape func Yimaxdiv(tls *TLS, num Tintmax_t, den Tintmax_t) (r Timaxdiv_t) +//go:noescape func Yindex(tls *TLS, s uintptr, c int32) (r uintptr) +//go:noescape func Yinet_addr(tls *TLS, p uintptr) (r Tin_addr_t) +//go:noescape func Yinet_aton(tls *TLS, s0 uintptr, dest uintptr) (r int32) +//go:noescape func Yinet_lnaof(tls *TLS, in Tin_addr) (r Tin_addr_t) +//go:noescape func Yinet_makeaddr(tls *TLS, n Tin_addr_t, h Tin_addr_t) (r Tin_addr) +//go:noescape func Yinet_netof(tls *TLS, in Tin_addr) (r Tin_addr_t) +//go:noescape func Yinet_network(tls *TLS, p uintptr) (r Tin_addr_t) +//go:noescape func Yinet_ntoa(tls *TLS, _in Tin_addr) (r uintptr) +//go:noescape func Yinet_ntop(tls *TLS, af int32, a0 uintptr, s uintptr, l Tsocklen_t) (r uintptr) +//go:noescape func Yinet_pton(tls *TLS, af int32, s uintptr, a0 uintptr) (r int32) +//go:noescape func Yinit_module(tls *TLS, a uintptr, b uint64, c uintptr) (r int32) +//go:noescape func Yinitstate(tls *TLS, seed uint32, state uintptr, size Tsize_t) (r uintptr) +//go:noescape func Yinitstate_r(t *TLS, seed uint32, statebuf uintptr, statelen Tsize_t, buf uintptr) int32 +//go:noescape func Yinotify_add_watch(tls *TLS, fd int32, pathname uintptr, mask Tuint32_t) (r int32) +//go:noescape func Yinotify_init(tls *TLS) (r int32) +//go:noescape func Yinotify_init1(tls *TLS, flags int32) (r1 int32) +//go:noescape func Yinotify_rm_watch(tls *TLS, fd int32, wd int32) (r int32) +//go:noescape func Yinsque(tls *TLS, element uintptr, pred uintptr) +//go:noescape func Yioctl(tls *TLS, fd int32, req int32, va uintptr) (r1 int32) +//go:noescape func Yioperm(tls *TLS, from uint64, num uint64, turn_on int32) (r int32) +//go:noescape func Yiopl(tls *TLS, level int32) (r int32) +//go:noescape func Yisalnum(tls *TLS, c int32) (r int32) +//go:noescape func Yisalnum_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yisalpha(tls *TLS, c int32) (r int32) +//go:noescape func Yisalpha_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yisascii(tls *TLS, c int32) (r int32) +//go:noescape func Yisastream(tls *TLS, fd int32) (r int32) +//go:noescape func Yisatty(tls *TLS, fd int32) (r1 int32) +//go:noescape func Yisblank(tls *TLS, c int32) (r int32) +//go:noescape func Yisblank_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yiscntrl(tls *TLS, c int32) (r int32) +//go:noescape func Yiscntrl_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yisdigit(tls *TLS, c int32) (r int32) +//go:noescape func Yisdigit_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yisgraph(tls *TLS, c int32) (r int32) +//go:noescape func Yisgraph_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yislower(tls *TLS, c int32) (r int32) +//go:noescape func Yislower_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yisnan(t *TLS, x float64) int32 +//go:noescape func Yisnanf(t *TLS, arg float32) int32 +//go:noescape func Yisnanl(t *TLS, arg float64) int32 +//go:noescape func Yisprint(tls *TLS, c int32) (r int32) +//go:noescape func Yisprint_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yispunct(tls *TLS, c int32) (r int32) +//go:noescape func Yispunct_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yissetugid(tls *TLS) (r int32) +//go:noescape func Yisspace(tls *TLS, c int32) (r int32) +//go:noescape func Yisspace_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yisupper(tls *TLS, c int32) (r int32) +//go:noescape func Yisupper_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yiswalnum(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswalnum_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswalpha(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswalpha_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswblank(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswblank_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswcntrl(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswcntrl_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswctype(tls *TLS, wc Twint_t, type1 Twctype_t) (r int32) +//go:noescape func Yiswctype_l(tls *TLS, c Twint_t, t Twctype_t, l Tlocale_t) (r int32) +//go:noescape func Yiswdigit(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswdigit_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswgraph(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswgraph_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswlower(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswlower_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswprint(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswprint_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswpunct(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswpunct_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswspace(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswspace_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswupper(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswupper_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yiswxdigit(tls *TLS, wc Twint_t) (r int32) +//go:noescape func Yiswxdigit_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) +//go:noescape func Yisxdigit(tls *TLS, c int32) (r int32) +//go:noescape func Yisxdigit_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Yj0(tls *TLS, x float64) (r1 float64) +//go:noescape func Yj0f(tls *TLS, x float32) (r1 float32) +//go:noescape func Yj1(tls *TLS, x float64) (r1 float64) +//go:noescape func Yj1f(tls *TLS, x float32) (r1 float32) +//go:noescape func Yjn(tls *TLS, n int32, x float64) (r float64) +//go:noescape func Yjnf(tls *TLS, n int32, x float32) (r float32) +//go:noescape func Yjrand48(tls *TLS, s uintptr) (r int64) +//go:noescape func Ykill(tls *TLS, pid Tpid_t, sig int32) (r int32) +//go:noescape func Ykillpg(tls *TLS, pgid Tpid_t, sig int32) (r int32) +//go:noescape func Yklogctl(tls *TLS, type1 int32, buf uintptr, len1 int32) (r int32) +//go:noescape func Yl64a(tls *TLS, x0 int64) (r uintptr) +//go:noescape func Ylabs(tls *TLS, a int64) (r int64) +//go:noescape func Ylchmod(tls *TLS, path uintptr, mode Tmode_t) (r int32) +//go:noescape func Ylchown(tls *TLS, path uintptr, uid Tuid_t, gid Tgid_t) (r int32) +//go:noescape func Ylckpwdf(tls *TLS) (r int32) +//go:noescape func Ylcong48(tls *TLS, p uintptr) +//go:noescape func Yldexp(tls *TLS, x float64, n int32) (r float64) +//go:noescape func Yldexpf(tls *TLS, x float32, n int32) (r float32) +//go:noescape func Yldexpl(tls *TLS, x float64, n int32) (r float64) +//go:noescape func Yldiv(tls *TLS, num int64, den int64) (r Tldiv_t) +//go:noescape func Ylfind(tls *TLS, key uintptr, base uintptr, nelp uintptr, width Tsize_t, compar uintptr) (r uintptr) +//go:noescape func Ylgamma(tls *TLS, x float64) (r float64) +//go:noescape func Ylgamma_r(tls *TLS, x float64, signgamp uintptr) (r float64) +//go:noescape func Ylgammaf(tls *TLS, x float32) (r float32) +//go:noescape func Ylgammaf_r(tls *TLS, x float32, signgamp uintptr) (r float32) +//go:noescape func Ylgammal(tls *TLS, x float64) (r float64) +//go:noescape func Ylgammal_r(tls *TLS, x float64, sg uintptr) (r float64) +//go:noescape func Ylgetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t) (r Tssize_t) +//go:noescape func Ylink(tls *TLS, existing uintptr, new1 uintptr) (r int32) +//go:noescape func Ylinkat(tls *TLS, fd1 int32, existing uintptr, fd2 int32, new1 uintptr, flag int32) (r int32) +//go:noescape func Ylisten(tls *TLS, fd int32, backlog int32) (r1 int32) +//go:noescape func Ylistxattr(tls *TLS, path uintptr, list uintptr, size Tsize_t) (r Tssize_t) +//go:noescape func Yllabs(tls *TLS, a int64) (r int64) +//go:noescape func Ylldiv(tls *TLS, num int64, den int64) (r Tlldiv_t) +//go:noescape func Yllistxattr(tls *TLS, path uintptr, list uintptr, size Tsize_t) (r Tssize_t) +//go:noescape func Yllrint(tls *TLS, x float64) (r int64) +//go:noescape func Yllrintf(tls *TLS, x float32) (r int64) +//go:noescape func Yllrintl(tls *TLS, x float64) (r int64) +//go:noescape func Yllround(tls *TLS, x float64) (r int64) +//go:noescape func Yllroundf(tls *TLS, x float32) (r int64) +//go:noescape func Yllroundl(tls *TLS, x float64) (r int64) +//go:noescape func Ylocaleconv(tls *TLS) (r uintptr) +//go:noescape func Ylocaltime(tls *TLS, t uintptr) (r uintptr) +//go:noescape func Ylocaltime_r(tls *TLS, t uintptr, tm uintptr) (r uintptr) +//go:noescape func Ylockf(tls *TLS, fd int32, op int32, size Toff_t) (r int32) +//go:noescape func Ylog(tls *TLS, x1 float64) (r1 float64) +//go:noescape func Ylog10(tls *TLS, x float64) (r float64) +//go:noescape func Ylog10f(tls *TLS, x float32) (r float32) +//go:noescape func Ylog10l(tls *TLS, x float64) (r float64) +//go:noescape func Ylog1p(tls *TLS, x3 float64) (r float64) +//go:noescape func Ylog1pf(tls *TLS, x3 float32) (r float32) +//go:noescape func Ylog1pl(tls *TLS, x float64) (r float64) +//go:noescape func Ylog2(tls *TLS, x1 float64) (r1 float64) +//go:noescape func Ylog2f(tls *TLS, x1 float32) (r1 float32) +//go:noescape func Ylog2l(tls *TLS, x float64) (r float64) +//go:noescape func Ylogb(tls *TLS, x float64) (r float64) +//go:noescape func Ylogbf(tls *TLS, x float32) (r float32) +//go:noescape func Ylogbl(tls *TLS, x float64) (r float64) +//go:noescape func Ylogf(tls *TLS, x1 float32) (r1 float32) +//go:noescape func Ylogin_tty(tls *TLS, fd int32) (r int32) +//go:noescape func Ylogl(tls *TLS, x float64) (r float64) +//go:noescape func Ylongjmp(t *TLS, env uintptr, val int32) +//go:noescape func Ylrand48(tls *TLS) (r int64) +//go:noescape func Ylremovexattr(tls *TLS, path uintptr, name uintptr) (r int32) +//go:noescape func Ylrint(tls *TLS, x float64) (r int64) +//go:noescape func Ylrintf(tls *TLS, x float32) (r int64) +//go:noescape func Ylrintl(tls *TLS, x float64) (r int64) +//go:noescape func Ylround(tls *TLS, x float64) (r int64) +//go:noescape func Ylroundf(tls *TLS, x float32) (r int64) +//go:noescape func Ylroundl(tls *TLS, x float64) (r int64) +//go:noescape func Ylsearch(tls *TLS, key uintptr, base uintptr, nelp uintptr, width Tsize_t, compar uintptr) (r uintptr) +//go:noescape func Ylseek(tls *TLS, fd int32, offset Toff_t, whence int32) (r Toff_t) +//go:noescape func Ylseek64(tls *TLS, fd int32, offset Toff_t, whence int32) (r Toff_t) +//go:noescape func Ylsetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t, flags int32) (r int32) +//go:noescape func Ylstat(tls *TLS, path uintptr, buf uintptr) (r int32) +//go:noescape func Ylstat64(tls *TLS, path uintptr, buf uintptr) (r int32) +//go:noescape func Ylutimes(tls *TLS, filename uintptr, tv uintptr) (r int32) +//go:noescape func Ymadvise(tls *TLS, addr uintptr, len1 Tsize_t, advice int32) (r int32) +//go:noescape func Ymalloc(tls *TLS, n Tsize_t) (r uintptr) +//go:noescape func Ymalloc_usable_size(tls *TLS, p uintptr) (r Tsize_t) +//go:noescape func Ymblen(tls *TLS, s uintptr, n Tsize_t) (r int32) +//go:noescape func Ymbrlen(tls *TLS, s uintptr, n Tsize_t, st uintptr) (r Tsize_t) +//go:noescape func Ymbrtoc16(tls *TLS, pc16 uintptr, s uintptr, n Tsize_t, ps uintptr) (r Tsize_t) +//go:noescape func Ymbrtoc32(tls *TLS, pc32 uintptr, s uintptr, n Tsize_t, ps uintptr) (r Tsize_t) +//go:noescape func Ymbrtowc(tls *TLS, wc uintptr, src uintptr, n Tsize_t, st uintptr) (r Tsize_t) +//go:noescape func Ymbsinit(tls *TLS, st uintptr) (r int32) +//go:noescape func Ymbsnrtowcs(tls *TLS, wcs uintptr, src uintptr, n Tsize_t, wn Tsize_t, st uintptr) (r Tsize_t) +//go:noescape func Ymbsrtowcs(tls *TLS, ws uintptr, src uintptr, wn Tsize_t, st uintptr) (r Tsize_t) +//go:noescape func Ymbstowcs(tls *TLS, ws uintptr, _s uintptr, wn Tsize_t) (r Tsize_t) +//go:noescape func Ymbtowc(tls *TLS, wc uintptr, src uintptr, n Tsize_t) (r int32) +//go:noescape func Ymemccpy(tls *TLS, dest uintptr, src uintptr, c int32, n Tsize_t) (r uintptr) +//go:noescape func Ymemchr(tls *TLS, src uintptr, c int32, n Tsize_t) (r uintptr) +//go:noescape func Ymemcmp(tls *TLS, vl uintptr, vr uintptr, n Tsize_t) (r1 int32) +//go:noescape func Ymemcpy(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ymemfd_create(tls *TLS, name uintptr, flags uint32) (r int32) +//go:noescape func Ymemmem(tls *TLS, h0 uintptr, k Tsize_t, n0 uintptr, l Tsize_t) (r uintptr) +//go:noescape func Ymemmove(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ymempcpy(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ymemrchr(tls *TLS, m uintptr, c int32, n Tsize_t) (r uintptr) +//go:noescape func Ymemset(tls *TLS, dest uintptr, c int32, n Tsize_t) (r uintptr) +//go:noescape func Ymincore(tls *TLS, addr uintptr, len1 Tsize_t, vec uintptr) (r int32) +//go:noescape func Ymkdir(tls *TLS, path uintptr, mode Tmode_t) (r int32) +//go:noescape func Ymkdirat(tls *TLS, fd int32, path uintptr, mode Tmode_t) (r int32) +//go:noescape func Ymkdtemp(tls *TLS, template uintptr) (r uintptr) +//go:noescape func Ymkfifo(tls *TLS, path uintptr, mode Tmode_t) (r int32) +//go:noescape func Ymkfifoat(tls *TLS, fd int32, path uintptr, mode Tmode_t) (r int32) +//go:noescape func Ymknod(tls *TLS, path uintptr, mode Tmode_t, dev Tdev_t) (r int32) +//go:noescape func Ymknodat(tls *TLS, fd int32, path uintptr, mode Tmode_t, dev Tdev_t) (r int32) +//go:noescape func Ymkostemp(tls *TLS, template uintptr, flags int32) (r int32) +//go:noescape func Ymkostemps(tls *TLS, template uintptr, len1 int32, flags int32) (r int32) +//go:noescape func Ymkstemp(tls *TLS, template uintptr) (r int32) +//go:noescape func Ymkstemp64(tls *TLS, template uintptr) (r int32) +//go:noescape func Ymkstemps(tls *TLS, template uintptr, len1 int32) (r int32) +//go:noescape func Ymkstemps64(tls *TLS, template uintptr, len1 int32) (r int32) +//go:noescape func Ymktemp(tls *TLS, template uintptr) (r uintptr) +//go:noescape func Ymktime(tls *TLS, tm uintptr) (r Ttime_t) +//go:noescape func Ymlock(tls *TLS, addr uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ymlock2(tls *TLS, addr uintptr, len1 Tsize_t, flags uint32) (r int32) +//go:noescape func Ymlockall(tls *TLS, flags int32) (r int32) +//go:noescape func Ymmap(tls *TLS, start uintptr, len1 Tsize_t, prot int32, flags int32, fd int32, off Toff_t) (r uintptr) +//go:noescape func Ymmap64(tls *TLS, start uintptr, len1 Tsize_t, prot int32, flags int32, fd int32, off Toff_t) (r uintptr) +//go:noescape func Ymodf(tls *TLS, x float64, iptr uintptr) (r float64) +//go:noescape func Ymodff(tls *TLS, x float32, iptr uintptr) (r float32) +//go:noescape func Ymodfl(tls *TLS, x float64, iptr uintptr) (r1 float64) +//go:noescape func Ymount(tls *TLS, special uintptr, dir uintptr, fstype uintptr, flags uint64, data uintptr) (r int32) +//go:noescape func Ymprotect(tls *TLS, addr uintptr, len1 Tsize_t, prot int32) (r int32) +//go:noescape func Ymrand48(tls *TLS) (r int64) +//go:noescape func Ymremap(tls *TLS, old_addr uintptr, old_len Tsize_t, new_len Tsize_t, flags int32, va uintptr) (r uintptr) +//go:noescape func Ymsgctl(tls *TLS, q int32, cmd int32, buf uintptr) (r1 int32) +//go:noescape func Ymsgget(tls *TLS, k Tkey_t, flag int32) (r int32) +//go:noescape func Ymsgrcv(tls *TLS, q int32, m uintptr, len1 Tsize_t, type1 int64, flag int32) (r Tssize_t) +//go:noescape func Ymsgsnd(tls *TLS, q int32, m uintptr, len1 Tsize_t, flag int32) (r int32) +//go:noescape func Ymsync(tls *TLS, start uintptr, len1 Tsize_t, flags int32) (r int32) +//go:noescape func Ymunlock(tls *TLS, addr uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ymunlockall(tls *TLS) (r int32) +//go:noescape func Ymunmap(tls *TLS, start uintptr, len1 Tsize_t) (r int32) +//go:noescape func Yname_to_handle_at(tls *TLS, dirfd int32, pathname uintptr, handle uintptr, mount_id uintptr, flags int32) (r int32) +//go:noescape func Ynan(tls *TLS, s uintptr) (r float64) +//go:noescape func Ynanf(tls *TLS, s uintptr) (r float32) +//go:noescape func Ynanl(tls *TLS, s uintptr) (r float64) +//go:noescape func Ynanosleep(tls *TLS, req uintptr, rem uintptr) (r int32) +//go:noescape func Ynewlocale(tls *TLS, mask int32, name uintptr, loc Tlocale_t) (r Tlocale_t) +//go:noescape func Ynextafter(tls *TLS, x3 float64, y3 float64) (r float64) +//go:noescape func Ynextafterf(tls *TLS, x3 float32, y3 float32) (r float32) +//go:noescape func Ynextafterl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Ynexttoward(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Ynexttowardf(tls *TLS, x3 float32, y3 float64) (r float32) +//go:noescape func Ynexttowardl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Ynftw(tls *TLS, path uintptr, fn uintptr, fd_limit int32, flags int32) (r1 int32) +//go:noescape func Yngettext(tls *TLS, msgid1 uintptr, msgid2 uintptr, n uint64) (r uintptr) +//go:noescape func Ynice(tls *TLS, inc int32) (r int32) +//go:noescape func Ynl_langinfo(tls *TLS, item Tnl_item) (r uintptr) +//go:noescape func Ynl_langinfo_l(tls *TLS, item Tnl_item, loc Tlocale_t) (r uintptr) +//go:noescape func Ynrand48(tls *TLS, s uintptr) (r int64) +//go:noescape func Yns_get16(tls *TLS, cp uintptr) (r uint32) +//go:noescape func Yns_get32(tls *TLS, cp uintptr) (r uint64) +//go:noescape func Yns_initparse(tls *TLS, msg uintptr, msglen int32, handle uintptr) (r1 int32) +//go:noescape func Yns_name_uncompress(tls *TLS, msg uintptr, eom uintptr, src uintptr, dst uintptr, dstsiz Tsize_t) (r1 int32) +//go:noescape func Yns_parserr(tls *TLS, handle uintptr, section Tns_sect, rrnum int32, rr uintptr) (r1 int32) +//go:noescape func Yns_put16(tls *TLS, s uint32, cp uintptr) +//go:noescape func Yns_put32(tls *TLS, l uint64, cp uintptr) +//go:noescape func Yns_skiprr(tls *TLS, ptr uintptr, eom uintptr, section Tns_sect, count int32) (r1 int32) +//go:noescape func Yntohl(tls *TLS, n Tuint32_t) (r Tuint32_t) +//go:noescape func Yntohs(tls *TLS, n Tuint16_t) (r Tuint16_t) +//go:noescape func Yobstack_free(t *TLS, obstack, obj uintptr) +//go:noescape func Yobstack_vprintf(t *TLS, obstack, template, va uintptr) int32 +//go:noescape func Yopen(tls *TLS, filename uintptr, flags int32, va uintptr) (r int32) +//go:noescape func Yopen64(tls *TLS, filename uintptr, flags int32, va uintptr) (r int32) +//go:noescape func Yopen_by_handle_at(tls *TLS, mount_fd int32, handle uintptr, flags int32) (r int32) +//go:noescape func Yopen_memstream(tls *TLS, bufp uintptr, sizep uintptr) (r uintptr) +//go:noescape func Yopen_wmemstream(tls *TLS, bufp uintptr, sizep uintptr) (r uintptr) +//go:noescape func Yopenat(tls *TLS, fd int32, filename uintptr, flags int32, va uintptr) (r int32) +//go:noescape func Yopendir(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Yopenlog(tls *TLS, ident uintptr, opt int32, facility int32) +//go:noescape func Yopenpty(tls *TLS, pm uintptr, ps uintptr, name uintptr, tio uintptr, ws uintptr) (r int32) +//go:noescape func Ypathconf(tls *TLS, path uintptr, name int32) (r int64) +//go:noescape func Ypause(tls *TLS) (r int32) +//go:noescape func Ypclose(tls *TLS, f uintptr) (r1 int32) +//go:noescape func Yperror(tls *TLS, msg uintptr) +//go:noescape func Ypersonality(tls *TLS, persona uint64) (r int32) +//go:noescape func Ypipe(tls *TLS, fd uintptr) (r int32) +//go:noescape func Ypipe2(tls *TLS, fd uintptr, flag int32) (r int32) +//go:noescape func Ypivot_root(tls *TLS, new1 uintptr, old uintptr) (r int32) +//go:noescape func Ypoll(tls *TLS, fds uintptr, n Tnfds_t, timeout int32) (r int32) +//go:noescape func Ypopen(t *TLS, command, type1 uintptr) uintptr +//go:noescape func Yposix_close(tls *TLS, fd int32, flags int32) (r int32) +//go:noescape func Yposix_fadvise(tls *TLS, fd int32, base Toff_t, len1 Toff_t, advice int32) (r int32) +//go:noescape func Yposix_fallocate(tls *TLS, fd int32, base Toff_t, len1 Toff_t) (r int32) +//go:noescape func Yposix_madvise(tls *TLS, addr uintptr, len1 Tsize_t, advice int32) (r int32) +//go:noescape func Yposix_openpt(tls *TLS, flags int32) (r1 int32) +//go:noescape func Yposix_spawn_file_actions_addchdir_np(tls *TLS, fa uintptr, path uintptr) (r int32) +//go:noescape func Yposix_spawn_file_actions_addclose(tls *TLS, fa uintptr, fd int32) (r int32) +//go:noescape func Yposix_spawn_file_actions_adddup2(tls *TLS, fa uintptr, srcfd int32, fd int32) (r int32) +//go:noescape func Yposix_spawn_file_actions_addfchdir_np(tls *TLS, fa uintptr, fd int32) (r int32) +//go:noescape func Yposix_spawn_file_actions_addopen(tls *TLS, fa uintptr, fd int32, path uintptr, flags int32, mode Tmode_t) (r int32) +//go:noescape func Yposix_spawn_file_actions_destroy(tls *TLS, fa uintptr) (r int32) +//go:noescape func Yposix_spawn_file_actions_init(tls *TLS, fa uintptr) (r int32) +//go:noescape func Yposix_spawnattr_destroy(tls *TLS, attr uintptr) (r int32) +//go:noescape func Yposix_spawnattr_getflags(tls *TLS, attr uintptr, flags uintptr) (r int32) +//go:noescape func Yposix_spawnattr_getpgroup(tls *TLS, attr uintptr, pgrp uintptr) (r int32) +//go:noescape func Yposix_spawnattr_getschedparam(tls *TLS, attr uintptr, schedparam uintptr) (r int32) +//go:noescape func Yposix_spawnattr_getschedpolicy(tls *TLS, attr uintptr, policy uintptr) (r int32) +//go:noescape func Yposix_spawnattr_getsigdefault(tls *TLS, attr uintptr, def uintptr) (r int32) +//go:noescape func Yposix_spawnattr_getsigmask(tls *TLS, attr uintptr, mask uintptr) (r int32) +//go:noescape func Yposix_spawnattr_init(tls *TLS, attr uintptr) (r int32) +//go:noescape func Yposix_spawnattr_setflags(tls *TLS, attr uintptr, flags int16) (r int32) +//go:noescape func Yposix_spawnattr_setpgroup(tls *TLS, attr uintptr, pgrp Tpid_t) (r int32) +//go:noescape func Yposix_spawnattr_setschedparam(tls *TLS, attr uintptr, schedparam uintptr) (r int32) +//go:noescape func Yposix_spawnattr_setschedpolicy(tls *TLS, attr uintptr, policy int32) (r int32) +//go:noescape func Yposix_spawnattr_setsigdefault(tls *TLS, attr uintptr, def uintptr) (r int32) +//go:noescape func Yposix_spawnattr_setsigmask(tls *TLS, attr uintptr, mask uintptr) (r int32) +//go:noescape func Ypow(tls *TLS, x1 float64, y1 float64) (r float64) +//go:noescape func Ypow10(tls *TLS, x float64) (r float64) +//go:noescape func Ypow10f(tls *TLS, x float32) (r float32) +//go:noescape func Ypow10l(tls *TLS, x float64) (r float64) +//go:noescape func Ypowf(tls *TLS, x1 float32, y1 float32) (r float32) +//go:noescape func Ypowl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yppoll(tls *TLS, fds uintptr, n Tnfds_t, to uintptr, mask uintptr) (r int32) +//go:noescape func Yprctl(tls *TLS, op int32, va uintptr) (r int32) +//go:noescape func Ypread(tls *TLS, fd int32, buf uintptr, size Tsize_t, ofs Toff_t) (r Tssize_t) +//go:noescape func Ypreadv(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t) (r Tssize_t) +//go:noescape func Ypreadv2(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t, flags int32) (r Tssize_t) +//go:noescape func Yprintf(tls *TLS, fmt uintptr, va uintptr) (r int32) +//go:noescape func Yprlimit(tls *TLS, pid Tpid_t, resource int32, new_limit uintptr, old_limit uintptr) (r1 int32) +//go:noescape func Yprocess_vm_readv(tls *TLS, pid Tpid_t, lvec uintptr, liovcnt uint64, rvec uintptr, riovcnt uint64, flags uint64) (r Tssize_t) +//go:noescape func Yprocess_vm_writev(tls *TLS, pid Tpid_t, lvec uintptr, liovcnt uint64, rvec uintptr, riovcnt uint64, flags uint64) (r Tssize_t) +//go:noescape func Ypselect(tls *TLS, n int32, rfds uintptr, wfds uintptr, efds uintptr, ts uintptr, mask uintptr) (r int32) +//go:noescape func Ypsiginfo(tls *TLS, si uintptr, msg uintptr) +//go:noescape func Ypsignal(tls *TLS, sig int32, msg uintptr) +//go:noescape func Ypthread_atfork(tls *TLS, prepare, parent, child uintptr) int32 +//go:noescape func Ypthread_attr_destroy(tls *TLS, a uintptr) int32 +//go:noescape func Ypthread_attr_getdetachstate(tls *TLS, a uintptr, state uintptr) int32 +//go:noescape func Ypthread_attr_init(tls *TLS, a uintptr) int32 +//go:noescape func Ypthread_attr_setdetachstate(tls *TLS, a uintptr, state int32) (r int32) +//go:noescape func Ypthread_attr_setscope(tls *TLS, a uintptr, scope int32) int32 +//go:noescape func Ypthread_attr_setstacksize(tls *TLS, a uintptr, stacksite Tsize_t) int32 +//go:noescape func Ypthread_cleanup_pop(tls *TLS, run int32) +//go:noescape func Ypthread_cleanup_push(tls *TLS, f, x uintptr) +//go:noescape func Ypthread_cond_broadcast(tls *TLS, c uintptr) int32 +//go:noescape func Ypthread_cond_destroy(tls *TLS, c uintptr) int32 +//go:noescape func Ypthread_cond_init(tls *TLS, c, a uintptr) int32 +//go:noescape func Ypthread_cond_signal(tls *TLS, c uintptr) int32 +//go:noescape func Ypthread_cond_timedwait(tls *TLS, c, m, ts uintptr) (r int32) +//go:noescape func Ypthread_cond_wait(tls *TLS, c, m uintptr) int32 +//go:noescape func Ypthread_create(tls *TLS, res, attrp, entry, arg uintptr) int32 +//go:noescape func Ypthread_detach(tls *TLS, t uintptr) int32 +//go:noescape func Ypthread_equal(tls *TLS, t, u uintptr) int32 +//go:noescape func Ypthread_exit(tls *TLS, result uintptr) +//go:noescape func Ypthread_getspecific(tls *TLS, k Tpthread_key_t) uintptr +//go:noescape func Ypthread_join(tls *TLS, t Tpthread_t, res uintptr) (r int32) +//go:noescape func Ypthread_key_create(tls *TLS, k uintptr, dtor uintptr) int32 +//go:noescape func Ypthread_key_delete(tls *TLS, k Tpthread_key_t) int32 +//go:noescape func Ypthread_mutex_destroy(tls *TLS, m uintptr) int32 +//go:noescape func Ypthread_mutex_init(tls *TLS, m, a uintptr) int32 +//go:noescape func Ypthread_mutex_lock(tls *TLS, m uintptr) int32 +//go:noescape func Ypthread_mutex_trylock(tls *TLS, m uintptr) int32 +//go:noescape func Ypthread_mutex_unlock(tls *TLS, m uintptr) int32 +//go:noescape func Ypthread_mutexattr_destroy(tls *TLS, a uintptr) int32 +//go:noescape func Ypthread_mutexattr_init(tls *TLS, a uintptr) int32 +//go:noescape func Ypthread_mutexattr_settype(tls *TLS, a uintptr, typ int32) int32 +//go:noescape func Ypthread_self(tls *TLS) uintptr +//go:noescape func Ypthread_setcancelstate(tls *TLS, new int32, old uintptr) int32 +//go:noescape func Ypthread_setspecific(tls *TLS, k Tpthread_key_t, x uintptr) int32 +//go:noescape func Ypthread_sigmask(tls *TLS, now int32, set, old uintptr) int32 +//go:noescape func Yptrace(tls *TLS, req int32, va uintptr) (r int64) +//go:noescape func Yptsname(tls *TLS, fd int32) (r uintptr) +//go:noescape func Yptsname_r(tls *TLS, fd int32, buf uintptr, len1 Tsize_t) (r int32) +//go:noescape func Yputc(tls *TLS, c1 int32, f1 uintptr) (r int32) +//go:noescape func Yputc_unlocked(tls *TLS, c int32, f uintptr) (r int32) +//go:noescape func Yputchar(tls *TLS, c1 int32) (r int32) +//go:noescape func Yputchar_unlocked(tls *TLS, c int32) (r int32) +//go:noescape func Yputenv(tls *TLS, s uintptr) (r int32) +//go:noescape func Yputgrent(tls *TLS, gr uintptr, f uintptr) (r1 int32) +//go:noescape func Yputpwent(tls *TLS, pw uintptr, f uintptr) (r int32) +//go:noescape func Yputs(tls *TLS, s uintptr) (r1 int32) +//go:noescape func Yputspent(tls *TLS, sp uintptr, f uintptr) (r int32) +//go:noescape func Ypututline(tls *TLS, ut uintptr) (r uintptr) +//go:noescape func Ypututxline(tls *TLS, ut uintptr) (r uintptr) +//go:noescape func Yputw(tls *TLS, _x int32, f uintptr) (r int32) +//go:noescape func Yputwc(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) +//go:noescape func Yputwc_unlocked(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) +//go:noescape func Yputwchar(tls *TLS, c Twchar_t) (r Twint_t) +//go:noescape func Yputwchar_unlocked(tls *TLS, c Twchar_t) (r Twint_t) +//go:noescape func Ypwrite(tls *TLS, fd int32, buf uintptr, size Tsize_t, ofs Toff_t) (r Tssize_t) +//go:noescape func Ypwritev(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t) (r Tssize_t) +//go:noescape func Ypwritev2(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t, flags int32) (r Tssize_t) +//go:noescape func Yqsort(tls *TLS, base uintptr, nel Tsize_t, width Tsize_t, cmp Tcmpfun) +//go:noescape func Yqsort_r(tls *TLS, base uintptr, nel Tsize_t, width Tsize_t, cmp Tcmpfun, arg uintptr) +//go:noescape func Yquick_exit(tls *TLS, code int32) +//go:noescape func Yquotactl(tls *TLS, cmd int32, special uintptr, id int32, addr uintptr) (r int32) +//go:noescape func Yraise(tls *TLS, sig int32) (r int32) +//go:noescape func Yrand(tls *TLS) (r int32) +//go:noescape func Yrand_r(tls *TLS, seed uintptr) (r int32) +//go:noescape func Yrandom(tls *TLS) (r int64) +//go:noescape func Yrandom_r(t *TLS, buf, result uintptr) int32 +//go:noescape func Yread(tls *TLS, fd int32, buf uintptr, count Tsize_t) (r Tssize_t) +//go:noescape func Yreadahead(tls *TLS, fd int32, pos Toff_t, len1 Tsize_t) (r Tssize_t) +//go:noescape func Yreaddir(tls *TLS, dir uintptr) (r uintptr) +//go:noescape func Yreaddir64(tls *TLS, dir uintptr) (r uintptr) +//go:noescape func Yreaddir_r(tls *TLS, dir uintptr, buf uintptr, result uintptr) (r int32) +//go:noescape func Yreadlink(tls *TLS, path uintptr, buf uintptr, bufsize Tsize_t) (r1 Tssize_t) +//go:noescape func Yreadlinkat(tls *TLS, fd int32, path uintptr, buf uintptr, bufsize Tsize_t) (r1 Tssize_t) +//go:noescape func Yreadv(tls *TLS, fd int32, iov uintptr, count int32) (r Tssize_t) +//go:noescape func Yrealloc(tls *TLS, p uintptr, n Tsize_t) (r uintptr) +//go:noescape func Yreallocarray(tls *TLS, ptr uintptr, m Tsize_t, n Tsize_t) (r uintptr) +//go:noescape func Yrealpath(tls *TLS, filename uintptr, resolved uintptr) (r uintptr) +//go:noescape func Yreboot(tls *TLS, type1 int32) (r int32) +//go:noescape func Yrecv(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32) (r Tssize_t) +//go:noescape func Yrecvfrom(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32, addr uintptr, alen uintptr) (r1 Tssize_t) +//go:noescape func Yrecvmmsg(tls *TLS, fd int32, msgvec uintptr, vlen uint32, flags uint32, timeout uintptr) (r int32) +//go:noescape func Yrecvmsg(tls *TLS, fd int32, msg uintptr, flags int32) (r2 Tssize_t) +//go:noescape func Yregcomp(tls *TLS, preg uintptr, regex uintptr, cflags int32) (r int32) +//go:noescape func Yregerror(tls *TLS, e int32, preg uintptr, buf uintptr, size Tsize_t) (r Tsize_t) +//go:noescape func Yregexec(tls *TLS, preg uintptr, string1 uintptr, nmatch Tsize_t, pmatch uintptr, eflags int32) (r int32) +//go:noescape func Yregfree(tls *TLS, preg uintptr) +//go:noescape func Yremainder(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yremainderf(tls *TLS, x float32, y float32) (r float32) +//go:noescape func Yremainderl(tls *TLS, x float64, y float64) (r float64) +//go:noescape func Yremap_file_pages(tls *TLS, addr uintptr, size Tsize_t, prot int32, pgoff Tsize_t, flags int32) (r int32) +//go:noescape func Yremove(tls *TLS, path uintptr) (r1 int32) +//go:noescape func Yremovexattr(tls *TLS, path uintptr, name uintptr) (r int32) +//go:noescape func Yremque(tls *TLS, element uintptr) +//go:noescape func Yremquo(tls *TLS, x float64, y float64, quo uintptr) (r float64) +//go:noescape func Yremquof(tls *TLS, x float32, y float32, quo uintptr) (r float32) +//go:noescape func Yremquol(tls *TLS, x float64, y float64, quo uintptr) (r float64) +//go:noescape func Yrename(tls *TLS, old uintptr, new1 uintptr) (r int32) +//go:noescape func Yrenameat(tls *TLS, oldfd int32, old uintptr, newfd int32, new1 uintptr) (r int32) +//go:noescape func Yrenameat2(t *TLS, olddirfd int32, oldpath uintptr, newdirfd int32, newpath uintptr, flags int32) int32 +//go:noescape func Yres_init(tls *TLS) (r int32) +//go:noescape func Yres_mkquery(tls *TLS, op int32, dname uintptr, class int32, type1 int32, data uintptr, datalen int32, newrr uintptr, buf uintptr, buflen int32) (r int32) +//go:noescape func Yres_send(tls *TLS, _msg uintptr, _msglen int32, _answer uintptr, _anslen int32) (r int32) +//go:noescape func Yrewind(tls *TLS, f uintptr) +//go:noescape func Yrewinddir(tls *TLS, dir uintptr) +//go:noescape func Yrindex(tls *TLS, s uintptr, c int32) (r uintptr) +//go:noescape func Yrint(tls *TLS, x float64) (r float64) +//go:noescape func Yrintf(tls *TLS, x float32) (r float32) +//go:noescape func Yrintl(tls *TLS, x float64) (r float64) +//go:noescape func Yrmdir(tls *TLS, path uintptr) (r int32) +//go:noescape func Yround(tls *TLS, x3 float64) (r float64) +//go:noescape func Yroundf(tls *TLS, x3 float32) (r float32) +//go:noescape func Yroundl(tls *TLS, x float64) (r float64) +//go:noescape func Ysbrk(tls *TLS, inc Tintptr_t) (r uintptr) +//go:noescape func Yscalb(tls *TLS, x float64, fn float64) (r float64) +//go:noescape func Yscalbf(tls *TLS, x float32, fn float32) (r float32) +//go:noescape func Yscalbln(tls *TLS, x float64, n int64) (r float64) +//go:noescape func Yscalblnf(tls *TLS, x float32, n int64) (r float32) +//go:noescape func Yscalblnl(tls *TLS, x float64, n int64) (r float64) +//go:noescape func Yscalbn(tls *TLS, x float64, n int32) (r float64) +//go:noescape func Yscalbnf(tls *TLS, x float32, n int32) (r float32) +//go:noescape func Yscalbnl(tls *TLS, x float64, n int32) (r float64) +//go:noescape func Yscandir(tls *TLS, path uintptr, res uintptr, sel uintptr, cmp uintptr) (r int32) +//go:noescape func Yscanf(tls *TLS, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ysched_yield(tls *TLS) int32 +//go:noescape func Ysecure_getenv(tls *TLS, name uintptr) (r uintptr) +//go:noescape func Yseed48(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Yseekdir(tls *TLS, dir uintptr, off int64) +//go:noescape func Yselect(tls *TLS, n int32, rfds uintptr, wfds uintptr, efds uintptr, tv uintptr) (r int32) +//go:noescape func Ysemctl(tls *TLS, id int32, num int32, cmd int32, va uintptr) (r1 int32) +//go:noescape func Ysemget(tls *TLS, key Tkey_t, n int32, fl int32) (r int32) +//go:noescape func Ysemop(tls *TLS, id int32, buf uintptr, n Tsize_t) (r int32) +//go:noescape func Ysemtimedop(tls *TLS, id int32, buf uintptr, n Tsize_t, ts uintptr) (r int32) +//go:noescape func Ysend(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32) (r Tssize_t) +//go:noescape func Ysendfile(tls *TLS, out_fd int32, in_fd int32, ofs uintptr, count Tsize_t) (r Tssize_t) +//go:noescape func Ysendmmsg(tls *TLS, fd int32, msgvec uintptr, vlen uint32, flags uint32) (r1 int32) +//go:noescape func Ysendmsg(tls *TLS, fd int32, msg uintptr, flags int32) (r1 Tssize_t) +//go:noescape func Ysendto(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32, addr uintptr, alen Tsocklen_t) (r1 Tssize_t) +//go:noescape func Ysetbuf(tls *TLS, f uintptr, buf uintptr) +//go:noescape func Ysetbuffer(tls *TLS, f uintptr, buf uintptr, size Tsize_t) +//go:noescape func Ysetdomainname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ysetenv(tls *TLS, var1 uintptr, value uintptr, overwrite int32) (r int32) +//go:noescape func Ysetfsgid(tls *TLS, gid Tgid_t) (r int32) +//go:noescape func Ysetfsuid(tls *TLS, uid Tuid_t) (r int32) +//go:noescape func Ysetgid(tls *TLS, gid Tgid_t) (r int32) +//go:noescape func Ysetgrent(tls *TLS) +//go:noescape func Ysethostent(tls *TLS, x int32) +//go:noescape func Ysethostname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) +//go:noescape func Ysetitimer(tls *TLS, which int32, new1 uintptr, old uintptr) (r1 int32) +//go:noescape func Ysetjmp(t *TLS, env uintptr) int32 +//go:noescape func Ysetkey(tls *TLS, key uintptr) +//go:noescape func Ysetlinebuf(tls *TLS, f uintptr) +//go:noescape func Ysetlocale(tls *TLS, cat int32, name uintptr) (r uintptr) +//go:noescape func Ysetlogmask(tls *TLS, maskpri int32) (r int32) +//go:noescape func Ysetmntent(tls *TLS, name uintptr, mode uintptr) (r uintptr) +//go:noescape func Ysetnetent(tls *TLS, x int32) +//go:noescape func Ysetns(tls *TLS, fd int32, nstype int32) (r int32) +//go:noescape func Ysetpgid(tls *TLS, pid Tpid_t, pgid Tpid_t) (r int32) +//go:noescape func Ysetpgrp(tls *TLS) (r Tpid_t) +//go:noescape func Ysetpriority(tls *TLS, which int32, who Tid_t, prio int32) (r int32) +//go:noescape func Ysetprotoent(tls *TLS, stayopen int32) +//go:noescape func Ysetpwent(tls *TLS) +//go:noescape func Ysetrlimit(tls *TLS, resource int32, rlim uintptr) (r int32) +//go:noescape func Ysetrlimit64(tls *TLS, resource int32, rlim uintptr) (r int32) +//go:noescape func Ysetservent(tls *TLS, stayopen int32) +//go:noescape func Ysetsid(tls *TLS) (r Tpid_t) +//go:noescape func Ysetsockopt(tls *TLS, fd int32, level int32, optname int32, optval uintptr, optlen Tsocklen_t) (r2 int32) +//go:noescape func Ysetspent(tls *TLS) +//go:noescape func Ysetstate(tls *TLS, state uintptr) (r uintptr) +//go:noescape func Ysettimeofday(tls *TLS, tv uintptr, tz uintptr) (r int32) +//go:noescape func Ysetuid(tls *TLS, uid Tuid_t) (r int32) +//go:noescape func Ysetusershell(tls *TLS) +//go:noescape func Ysetutent(tls *TLS) +//go:noescape func Ysetutxent(tls *TLS) +//go:noescape func Ysetvbuf(tls *TLS, f uintptr, buf uintptr, type1 int32, size Tsize_t) (r int32) +//go:noescape func Ysetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t, flags int32) (r int32) +//go:noescape func Yshm_open(tls *TLS, name uintptr, flag int32, mode Tmode_t) (r int32) +//go:noescape func Yshm_unlink(tls *TLS, name uintptr) (r int32) +//go:noescape func Yshmat(tls *TLS, id int32, addr uintptr, flag int32) (r uintptr) +//go:noescape func Yshmctl(tls *TLS, id int32, cmd int32, buf uintptr) (r1 int32) +//go:noescape func Yshmdt(tls *TLS, addr uintptr) (r int32) +//go:noescape func Yshmget(tls *TLS, key Tkey_t, size Tsize_t, flag int32) (r int32) +//go:noescape func Yshutdown(tls *TLS, fd int32, how int32) (r1 int32) +//go:noescape func Ysigaction(tls *TLS, sig int32, sa uintptr, old uintptr) (r int32) +//go:noescape func Ysigaddset(tls *TLS, set uintptr, sig int32) (r int32) +//go:noescape func Ysigaltstack(tls *TLS, ss uintptr, old uintptr) (r int32) +//go:noescape func Ysigandset(tls *TLS, dest uintptr, left uintptr, right uintptr) (r1 int32) +//go:noescape func Ysigdelset(tls *TLS, set uintptr, sig int32) (r int32) +//go:noescape func Ysigemptyset(tls *TLS, set uintptr) (r int32) +//go:noescape func Ysigfillset(tls *TLS, set uintptr) (r int32) +//go:noescape func Ysigisemptyset(tls *TLS, set uintptr) (r int32) +//go:noescape func Ysigismember(tls *TLS, set uintptr, sig int32) (r int32) +//go:noescape func Ysignal(tls *TLS, signum int32, handler uintptr) (r uintptr) +//go:noescape func Ysignalfd(tls *TLS, fd int32, sigs uintptr, flags int32) (r int32) +//go:noescape func Ysignificand(tls *TLS, x float64) (r float64) +//go:noescape func Ysignificandf(tls *TLS, x float32) (r float32) +//go:noescape func Ysigorset(tls *TLS, dest uintptr, left uintptr, right uintptr) (r1 int32) +//go:noescape func Ysigpending(tls *TLS, set uintptr) (r int32) +//go:noescape func Ysigprocmask(tls *TLS, how int32, set uintptr, old uintptr) (r1 int32) +//go:noescape func Ysigqueue(tls *TLS, pid Tpid_t, sig int32, value Tsigval) (r1 int32) +//go:noescape func Ysigsuspend(tls *TLS, mask uintptr) (r int32) +//go:noescape func Ysigtimedwait(tls *TLS, mask uintptr, si uintptr, timeout uintptr) (r int32) +//go:noescape func Ysigwait(tls *TLS, mask uintptr, sig uintptr) (r int32) +//go:noescape func Ysigwaitinfo(tls *TLS, mask uintptr, si uintptr) (r int32) +//go:noescape func Ysin(tls *TLS, x3 float64) (r float64) +//go:noescape func Ysincos(tls *TLS, x3 float64, sin uintptr, cos uintptr) +//go:noescape func Ysincosf(tls *TLS, x3 float32, sin uintptr, cos uintptr) +//go:noescape func Ysincosl(tls *TLS, x float64, sin uintptr, cos uintptr) +//go:noescape func Ysinf(tls *TLS, x3 float32) (r float32) +//go:noescape func Ysinh(tls *TLS, x float64) (r float64) +//go:noescape func Ysinhf(tls *TLS, x float32) (r float32) +//go:noescape func Ysinhl(tls *TLS, x float64) (r float64) +//go:noescape func Ysinl(tls *TLS, x float64) (r float64) +//go:noescape func Ysleep(tls *TLS, seconds uint32) (r uint32) +//go:noescape func Ysnprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ysockatmark(tls *TLS, s int32) (r int32) +//go:noescape func Ysocket(tls *TLS, domain int32, type1 int32, protocol int32) (r1 int32) +//go:noescape func Ysocketpair(tls *TLS, domain int32, type1 int32, protocol int32, fd uintptr) (r2 int32) +//go:noescape func Ysplice(tls *TLS, fd_in int32, off_in uintptr, fd_out int32, off_out uintptr, len1 Tsize_t, flags uint32) (r Tssize_t) +//go:noescape func Ysprintf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ysqrt(tls *TLS, x1 float64) (r1 float64) +//go:noescape func Ysqrtf(tls *TLS, x1 float32) (r1 float32) +//go:noescape func Ysqrtl(tls *TLS, x float64) (r float64) +//go:noescape func Ysrand(tls *TLS, s uint32) +//go:noescape func Ysrand48(tls *TLS, seed int64) +//go:noescape func Ysrandom(tls *TLS, seed uint32) +//go:noescape func Ysscanf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ystat(tls *TLS, path uintptr, buf uintptr) (r int32) +//go:noescape func Ystat64(tls *TLS, path uintptr, buf uintptr) (r int32) +//go:noescape func Ystatvfs(tls *TLS, path uintptr, buf uintptr) (r int32) +//go:noescape func Ystatx(tls *TLS, dirfd int32, path uintptr, flags int32, mask uint32, stx uintptr) (r int32) +//go:noescape func Ystime(tls *TLS, t uintptr) (r int32) +//go:noescape func Ystpcpy(tls *TLS, d uintptr, s uintptr) (r uintptr) +//go:noescape func Ystpncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ystrcasecmp(tls *TLS, _l uintptr, _r uintptr) (r1 int32) +//go:noescape func Ystrcasecmp_l(tls *TLS, l uintptr, r uintptr, loc Tlocale_t) (r1 int32) +//go:noescape func Ystrcasestr(tls *TLS, h uintptr, n uintptr) (r uintptr) +//go:noescape func Ystrcat(tls *TLS, dest uintptr, src uintptr) (r uintptr) +//go:noescape func Ystrchr(tls *TLS, s uintptr, c int32) (r1 uintptr) +//go:noescape func Ystrchrnul(tls *TLS, s uintptr, c int32) (r uintptr) +//go:noescape func Ystrcmp(tls *TLS, l uintptr, r uintptr) (r1 int32) +//go:noescape func Ystrcoll(tls *TLS, l uintptr, r uintptr) (r1 int32) +//go:noescape func Ystrcoll_l(tls *TLS, l uintptr, r uintptr, loc Tlocale_t) (r1 int32) +//go:noescape func Ystrcpy(tls *TLS, dest uintptr, src uintptr) (r uintptr) +//go:noescape func Ystrcspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) +//go:noescape func Ystrdup(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Ystrerror(tls *TLS, e int32) (r uintptr) +//go:noescape func Ystrerror_l(tls *TLS, e int32, loc Tlocale_t) (r uintptr) +//go:noescape func Ystrerror_r(tls *TLS, err int32, buf uintptr, buflen Tsize_t) (r int32) +//go:noescape func Ystrfmon(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, va uintptr) (r Tssize_t) +//go:noescape func Ystrfmon_l(tls *TLS, s uintptr, n Tsize_t, loc Tlocale_t, fmt uintptr, va uintptr) (r Tssize_t) +//go:noescape func Ystrftime(tls *TLS, s uintptr, n Tsize_t, f uintptr, tm uintptr) (r Tsize_t) +//go:noescape func Ystrftime_l(tls *TLS, s uintptr, n Tsize_t, f uintptr, tm uintptr, loc Tlocale_t) (r Tsize_t) +//go:noescape func Ystrlcat(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r Tsize_t) +//go:noescape func Ystrlcpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r Tsize_t) +//go:noescape func Ystrlen(tls *TLS, s uintptr) (r Tsize_t) +//go:noescape func Ystrncasecmp(tls *TLS, _l uintptr, _r uintptr, n Tsize_t) (r1 int32) +//go:noescape func Ystrncasecmp_l(tls *TLS, l uintptr, r uintptr, n Tsize_t, loc Tlocale_t) (r1 int32) +//go:noescape func Ystrncat(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ystrncmp(tls *TLS, _l uintptr, _r uintptr, n Tsize_t) (r1 int32) +//go:noescape func Ystrncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ystrndup(tls *TLS, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ystrnlen(tls *TLS, s uintptr, n Tsize_t) (r Tsize_t) +//go:noescape func Ystrpbrk(tls *TLS, s uintptr, b uintptr) (r uintptr) +//go:noescape func Ystrptime(tls *TLS, s uintptr, f uintptr, tm uintptr) (r uintptr) +//go:noescape func Ystrrchr(tls *TLS, s uintptr, c int32) (r uintptr) +//go:noescape func Ystrsep(tls *TLS, str uintptr, sep uintptr) (r uintptr) +//go:noescape func Ystrsignal(tls *TLS, signum int32) (r uintptr) +//go:noescape func Ystrspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) +//go:noescape func Ystrstr(tls *TLS, h uintptr, n uintptr) (r uintptr) +//go:noescape func Ystrtod(tls *TLS, s uintptr, p uintptr) (r float64) +//go:noescape func Ystrtod_l(tls *TLS, s uintptr, p uintptr, l Tlocale_t) (r float64) +//go:noescape func Ystrtof(tls *TLS, s uintptr, p uintptr) (r float32) +//go:noescape func Ystrtof_l(tls *TLS, s uintptr, p uintptr, l Tlocale_t) (r float32) +//go:noescape func Ystrtoimax(tls *TLS, s uintptr, p uintptr, base int32) (r Tintmax_t) +//go:noescape func Ystrtok(tls *TLS, s uintptr, sep uintptr) (r uintptr) +//go:noescape func Ystrtok_r(tls *TLS, s uintptr, sep uintptr, p uintptr) (r uintptr) +//go:noescape func Ystrtol(tls *TLS, s uintptr, p uintptr, base int32) (r int64) +//go:noescape func Ystrtold(tls *TLS, s uintptr, p uintptr) (r float64) +//go:noescape func Ystrtold_l(tls *TLS, s uintptr, p uintptr, l Tlocale_t) (r float64) +//go:noescape func Ystrtoll(tls *TLS, s uintptr, p uintptr, base int32) (r int64) +//go:noescape func Ystrtoul(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) +//go:noescape func Ystrtoull(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) +//go:noescape func Ystrtoumax(tls *TLS, s uintptr, p uintptr, base int32) (r Tuintmax_t) +//go:noescape func Ystrverscmp(tls *TLS, l0 uintptr, r0 uintptr) (r1 int32) +//go:noescape func Ystrxfrm(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r Tsize_t) +//go:noescape func Ystrxfrm_l(tls *TLS, dest uintptr, src uintptr, n Tsize_t, loc Tlocale_t) (r Tsize_t) +//go:noescape func Yswab(tls *TLS, _src uintptr, _dest uintptr, n Tssize_t) +//go:noescape func Yswapoff(tls *TLS, path uintptr) (r int32) +//go:noescape func Yswapon(tls *TLS, path uintptr, flags int32) (r int32) +//go:noescape func Yswprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, va uintptr) (r int32) +//go:noescape func Yswscanf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ysymlink(tls *TLS, existing uintptr, new1 uintptr) (r int32) +//go:noescape func Ysymlinkat(tls *TLS, existing uintptr, fd int32, new1 uintptr) (r int32) +//go:noescape func Ysync(tls *TLS) +//go:noescape func Ysync_file_range(tls *TLS, fd int32, pos Toff_t, len1 Toff_t, flags uint32) (r int32) +//go:noescape func Ysyncfs(tls *TLS, fd int32) (r int32) +//go:noescape func Ysyscall(tls *TLS, n int64, va uintptr) (r int64) +//go:noescape func Ysysconf(tls *TLS, name int32) (r int64) +//go:noescape func Ysysctlbyname(t *TLS, name, oldp, oldlenp, newp uintptr, newlen Tsize_t) int32 +//go:noescape func Ysysinfo(tls *TLS, info uintptr) (r int32) +//go:noescape func Ysyslog(tls *TLS, priority int32, message uintptr, va uintptr) +//go:noescape func Ysystem(t *TLS, command uintptr) int32 +//go:noescape func Ytan(tls *TLS, x3 float64) (r float64) +//go:noescape func Ytanf(tls *TLS, x3 float32) (r float32) +//go:noescape func Ytanh(tls *TLS, x3 float64) (r float64) +//go:noescape func Ytanhf(tls *TLS, x3 float32) (r float32) +//go:noescape func Ytanhl(tls *TLS, x float64) (r float64) +//go:noescape func Ytanl(tls *TLS, x float64) (r float64) +//go:noescape func Ytcdrain(tls *TLS, fd int32) (r int32) +//go:noescape func Ytcflow(tls *TLS, fd int32, action int32) (r int32) +//go:noescape func Ytcflush(tls *TLS, fd int32, queue int32) (r int32) +//go:noescape func Ytcgetattr(tls *TLS, fd int32, tio uintptr) (r int32) +//go:noescape func Ytcgetpgrp(tls *TLS, fd int32) (r Tpid_t) +//go:noescape func Ytcgetsid(tls *TLS, fd int32) (r Tpid_t) +//go:noescape func Ytcgetwinsize(tls *TLS, fd int32, wsz uintptr) (r int32) +//go:noescape func Ytcsendbreak(tls *TLS, fd int32, dur int32) (r int32) +//go:noescape func Ytcsetattr(tls *TLS, fd int32, act int32, tio uintptr) (r int32) +//go:noescape func Ytcsetpgrp(tls *TLS, fd int32, pgrp Tpid_t) (r int32) +//go:noescape func Ytcsetwinsize(tls *TLS, fd int32, wsz uintptr) (r int32) +//go:noescape func Ytdelete(tls *TLS, key uintptr, rootp uintptr, cmp uintptr) (r uintptr) +//go:noescape func Ytdestroy(tls *TLS, root uintptr, freekey uintptr) +//go:noescape func Ytee(tls *TLS, src int32, dest int32, len1 Tsize_t, flags uint32) (r Tssize_t) +//go:noescape func Ytelldir(tls *TLS, dir uintptr) (r int64) +//go:noescape func Ytempnam(tls *TLS, dir uintptr, pfx uintptr) (r1 uintptr) +//go:noescape func Ytextdomain(tls *TLS, domainname uintptr) (r uintptr) +//go:noescape func Ytfind(tls *TLS, key uintptr, rootp uintptr, cmp uintptr) (r uintptr) +//go:noescape func Ytgamma(tls *TLS, x3 float64) (r1 float64) +//go:noescape func Ytgammaf(tls *TLS, x float32) (r float32) +//go:noescape func Ytgammal(tls *TLS, x float64) (r float64) +//go:noescape func Ytime(tls *TLS, t uintptr) (r Ttime_t) +//go:noescape func Ytimegm(tls *TLS, tm uintptr) (r Ttime_t) +//go:noescape func Ytimer_delete(tls *TLS, t Ttimer_t) (r int32) +//go:noescape func Ytimer_getoverrun(tls *TLS, t Ttimer_t) (r int32) +//go:noescape func Ytimer_gettime(tls *TLS, t Ttimer_t, val uintptr) (r int32) +//go:noescape func Ytimer_settime(tls *TLS, t Ttimer_t, flags int32, val uintptr, old uintptr) (r int32) +//go:noescape func Ytimerfd_create(tls *TLS, clockid int32, flags int32) (r int32) +//go:noescape func Ytimerfd_gettime(tls *TLS, fd int32, cur uintptr) (r int32) +//go:noescape func Ytimerfd_settime(tls *TLS, fd int32, flags int32, new1 uintptr, old uintptr) (r int32) +//go:noescape func Ytimes(tls *TLS, tms uintptr) (r Tclock_t) +//go:noescape func Ytimespec_get(tls *TLS, ts uintptr, base int32) (r int32) +//go:noescape func Ytmpfile(tls *TLS) (r uintptr) +//go:noescape func Ytmpnam(tls *TLS, buf uintptr) (r1 uintptr) +//go:noescape func Ytoascii(tls *TLS, c int32) (r int32) +//go:noescape func Ytolower(tls *TLS, c int32) (r int32) +//go:noescape func Ytolower_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Ytoupper(tls *TLS, c int32) (r int32) +//go:noescape func Ytoupper_l(tls *TLS, c int32, l Tlocale_t) (r int32) +//go:noescape func Ytowctrans(tls *TLS, wc Twint_t, trans Twctrans_t) (r Twint_t) +//go:noescape func Ytowctrans_l(tls *TLS, c Twint_t, t Twctrans_t, l Tlocale_t) (r Twint_t) +//go:noescape func Ytowlower(tls *TLS, wc Twint_t) (r Twint_t) +//go:noescape func Ytowlower_l(tls *TLS, c Twint_t, l Tlocale_t) (r Twint_t) +//go:noescape func Ytowupper(tls *TLS, wc Twint_t) (r Twint_t) +//go:noescape func Ytowupper_l(tls *TLS, c Twint_t, l Tlocale_t) (r Twint_t) +//go:noescape func Ytrunc(tls *TLS, x3 float64) (r float64) +//go:noescape func Ytruncate(tls *TLS, path uintptr, length Toff_t) (r int32) +//go:noescape func Ytruncf(tls *TLS, x3 float32) (r float32) +//go:noescape func Ytruncl(tls *TLS, x float64) (r float64) +//go:noescape func Ytsearch(tls *TLS, key uintptr, rootp uintptr, cmp uintptr) (r1 uintptr) +//go:noescape func Yttyname(tls *TLS, fd int32) (r uintptr) +//go:noescape func Yttyname_r(tls *TLS, fd int32, name uintptr, size Tsize_t) (r int32) +//go:noescape func Ytwalk(tls *TLS, root uintptr, action uintptr) +//go:noescape func Ytzset(tls *TLS) +//go:noescape func Yualarm(tls *TLS, value uint32, interval uint32) (r uint32) +//go:noescape func Yulckpwdf(tls *TLS) (r int32) +//go:noescape func Yulimit(tls *TLS, cmd int32, va uintptr) (r int64) +//go:noescape func Yumask(tls *TLS, mode Tmode_t) (r Tmode_t) +//go:noescape func Yumount(tls *TLS, special uintptr) (r int32) +//go:noescape func Yumount2(tls *TLS, special uintptr, flags int32) (r int32) +//go:noescape func Yuname(tls *TLS, uts uintptr) (r int32) +//go:noescape func Yungetc(tls *TLS, c int32, f uintptr) (r int32) +//go:noescape func Yungetwc(tls *TLS, c Twint_t, f uintptr) (r Twint_t) +//go:noescape func Yunlink(tls *TLS, path uintptr) (r int32) +//go:noescape func Yunlinkat(tls *TLS, fd int32, path uintptr, flag int32) (r int32) +//go:noescape func Yunlockpt(tls *TLS, fd int32) (r int32) +//go:noescape func Yunsetenv(tls *TLS, name uintptr) (r int32) +//go:noescape func Yunshare(tls *TLS, flags int32) (r int32) +//go:noescape func Yupdwtmp(tls *TLS, f uintptr, u uintptr) +//go:noescape func Yupdwtmpx(tls *TLS, f uintptr, u uintptr) +//go:noescape func Yuselocale(tls *TLS, new1 Tlocale_t) (r Tlocale_t) +//go:noescape func Yusleep(tls *TLS, useconds uint32) (r int32) +//go:noescape func Yutime(tls *TLS, path uintptr, times uintptr) (r int32) +//go:noescape func Yutimensat(tls *TLS, fd int32, path uintptr, times uintptr, flags int32) (r1 int32) +//go:noescape func Yutimes(tls *TLS, path uintptr, times uintptr) (r int32) +//go:noescape func Yuuid_copy(t *TLS, dst, src uintptr) +//go:noescape func Yuuid_generate_random(t *TLS, out uintptr) +//go:noescape func Yuuid_parse(t *TLS, in uintptr, uu uintptr) int32 +//go:noescape func Yuuid_unparse(t *TLS, uu, out uintptr) +//go:noescape func Yvasprintf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvdprintf(tls *TLS, fd int32, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yverr(tls *TLS, status int32, fmt uintptr, ap Tva_list) +//go:noescape func Yverrx(tls *TLS, status int32, fmt uintptr, ap Tva_list) +//go:noescape func Yversionsort(tls *TLS, a uintptr, b uintptr) (r int32) +//go:noescape func Yvfork(tls *TLS) (r Tpid_t) +//go:noescape func Yvfprintf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvfscanf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvfwprintf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvfwscanf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvhangup(tls *TLS) (r int32) +//go:noescape func Yvmsplice(tls *TLS, fd int32, iov uintptr, cnt Tsize_t, flags uint32) (r Tssize_t) +//go:noescape func Yvprintf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvscanf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvsnprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvsprintf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvsscanf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvswprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, ap Tva_list) (r1 int32) +//go:noescape func Yvswscanf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvwarn(tls *TLS, fmt uintptr, ap Tva_list) +//go:noescape func Yvwarnx(tls *TLS, fmt uintptr, ap Tva_list) +//go:noescape func Yvwprintf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Yvwscanf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) +//go:noescape func Ywait(tls *TLS, status uintptr) (r Tpid_t) +//go:noescape func Ywait3(tls *TLS, status uintptr, options int32, usage uintptr) (r Tpid_t) +//go:noescape func Ywait4(tls *TLS, pid Tpid_t, status uintptr, options int32, ru uintptr) (r1 Tpid_t) +//go:noescape func Ywaitid(tls *TLS, type1 Tidtype_t, id Tid_t, info uintptr, options int32) (r int32) +//go:noescape func Ywaitpid(tls *TLS, pid Tpid_t, status uintptr, options int32) (r Tpid_t) +//go:noescape func Ywarn(tls *TLS, fmt uintptr, va uintptr) +//go:noescape func Ywarnx(tls *TLS, fmt uintptr, va uintptr) +//go:noescape func Ywcpcpy(tls *TLS, d uintptr, s uintptr) (r uintptr) +//go:noescape func Ywcpncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ywcrtomb(tls *TLS, s uintptr, wc Twchar_t, st uintptr) (r Tsize_t) +//go:noescape func Ywcscasecmp(tls *TLS, l uintptr, r uintptr) (r1 int32) +//go:noescape func Ywcscasecmp_l(tls *TLS, l uintptr, r uintptr, locale Tlocale_t) (r1 int32) +//go:noescape func Ywcscat(tls *TLS, dest uintptr, src uintptr) (r uintptr) +//go:noescape func Ywcschr(tls *TLS, s uintptr, c Twchar_t) (r uintptr) +//go:noescape func Ywcscmp(tls *TLS, l uintptr, r uintptr) (r1 int32) +//go:noescape func Ywcscoll(tls *TLS, l uintptr, r uintptr) (r1 int32) +//go:noescape func Ywcscoll_l(tls *TLS, l uintptr, r uintptr, locale Tlocale_t) (r1 int32) +//go:noescape func Ywcscpy(tls *TLS, d uintptr, s uintptr) (r uintptr) +//go:noescape func Ywcscspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) +//go:noescape func Ywcsdup(tls *TLS, s uintptr) (r uintptr) +//go:noescape func Ywcsftime(tls *TLS, wcs uintptr, n Tsize_t, f uintptr, tm uintptr) (r Tsize_t) +//go:noescape func Ywcsftime_l(tls *TLS, s uintptr, n Tsize_t, f uintptr, tm uintptr, loc Tlocale_t) (r Tsize_t) +//go:noescape func Ywcslen(tls *TLS, s uintptr) (r Tsize_t) +//go:noescape func Ywcsncasecmp(tls *TLS, l uintptr, r uintptr, n Tsize_t) (r1 int32) +//go:noescape func Ywcsncasecmp_l(tls *TLS, l uintptr, r uintptr, n Tsize_t, locale Tlocale_t) (r1 int32) +//go:noescape func Ywcsncat(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ywcsncmp(tls *TLS, l uintptr, r uintptr, n Tsize_t) (r1 int32) +//go:noescape func Ywcsncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ywcsnlen(tls *TLS, s uintptr, n Tsize_t) (r Tsize_t) +//go:noescape func Ywcsnrtombs(tls *TLS, dst uintptr, wcs uintptr, wn Tsize_t, n Tsize_t, st uintptr) (r Tsize_t) +//go:noescape func Ywcspbrk(tls *TLS, s uintptr, b uintptr) (r uintptr) +//go:noescape func Ywcsrchr(tls *TLS, s uintptr, c Twchar_t) (r uintptr) +//go:noescape func Ywcsrtombs(tls *TLS, s uintptr, ws uintptr, n Tsize_t, st uintptr) (r Tsize_t) +//go:noescape func Ywcsspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) +//go:noescape func Ywcsstr(tls *TLS, h uintptr, n uintptr) (r uintptr) +//go:noescape func Ywcstod(tls *TLS, s uintptr, p uintptr) (r float64) +//go:noescape func Ywcstof(tls *TLS, s uintptr, p uintptr) (r float32) +//go:noescape func Ywcstoimax(tls *TLS, s uintptr, p uintptr, base int32) (r Tintmax_t) +//go:noescape func Ywcstok(tls *TLS, s uintptr, sep uintptr, p uintptr) (r uintptr) +//go:noescape func Ywcstol(tls *TLS, s uintptr, p uintptr, base int32) (r int64) +//go:noescape func Ywcstold(tls *TLS, s uintptr, p uintptr) (r float64) +//go:noescape func Ywcstoll(tls *TLS, s uintptr, p uintptr, base int32) (r int64) +//go:noescape func Ywcstombs(tls *TLS, s uintptr, ws uintptr, n Tsize_t) (r Tsize_t) +//go:noescape func Ywcstoul(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) +//go:noescape func Ywcstoull(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) +//go:noescape func Ywcstoumax(tls *TLS, s uintptr, p uintptr, base int32) (r Tuintmax_t) +//go:noescape func Ywcswcs(tls *TLS, haystack uintptr, needle uintptr) (r uintptr) +//go:noescape func Ywcswidth(tls *TLS, wcs uintptr, n Tsize_t) (r int32) +//go:noescape func Ywcsxfrm(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r Tsize_t) +//go:noescape func Ywcsxfrm_l(tls *TLS, dest uintptr, src uintptr, n Tsize_t, loc Tlocale_t) (r Tsize_t) +//go:noescape func Ywctob(tls *TLS, c Twint_t) (r int32) +//go:noescape func Ywctomb(tls *TLS, s uintptr, wc Twchar_t) (r int32) +//go:noescape func Ywctrans(tls *TLS, class uintptr) (r Twctrans_t) +//go:noescape func Ywctrans_l(tls *TLS, s uintptr, l Tlocale_t) (r Twctrans_t) +//go:noescape func Ywctype(tls *TLS, s uintptr) (r Twctype_t) +//go:noescape func Ywctype_l(tls *TLS, s uintptr, l Tlocale_t) (r Twctype_t) +//go:noescape func Ywcwidth(tls *TLS, wc Twchar_t) (r int32) +//go:noescape func Ywmemchr(tls *TLS, s uintptr, c Twchar_t, n Tsize_t) (r uintptr) +//go:noescape func Ywmemcmp(tls *TLS, l uintptr, r uintptr, n Tsize_t) (r1 int32) +//go:noescape func Ywmemcpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ywmemmove(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) +//go:noescape func Ywmemset(tls *TLS, d uintptr, c Twchar_t, n Tsize_t) (r uintptr) +//go:noescape func Ywprintf(tls *TLS, fmt uintptr, va uintptr) (r int32) +//go:noescape func Ywrite(tls *TLS, fd int32, buf uintptr, count Tsize_t) (r Tssize_t) +//go:noescape func Ywritev(tls *TLS, fd int32, iov uintptr, count int32) (r Tssize_t) +//go:noescape func Ywscanf(tls *TLS, fmt uintptr, va uintptr) (r int32) +//go:noescape func Yy0(tls *TLS, x float64) (r float64) +//go:noescape func Yy0f(tls *TLS, x float32) (r float32) +//go:noescape func Yy1(tls *TLS, x float64) (r float64) +//go:noescape func Yy1f(tls *TLS, x float32) (r float32) +//go:noescape func Yyn(tls *TLS, n int32, x float64) (r float64) +//go:noescape func Yynf(tls *TLS, n int32, x float32) (r float32) diff --git a/vendor/modernc.org/libc/asm_linux_amd64.s b/vendor/modernc.org/libc/asm_linux_amd64.s index 25927f6bd4..a847bbf115 100644 --- a/vendor/modernc.org/libc/asm_linux_amd64.s +++ b/vendor/modernc.org/libc/asm_linux_amd64.s @@ -1,9 +1,12 @@ // Code generated for linux/amd64 by 'genasm', DO NOT EDIT. +#include "funcdata.h" #include "textflag.h" // func Ya64l(tls *TLS, s uintptr) (r int64) TEXT ·Ya64l(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -15,6 +18,8 @@ TEXT ·Ya64l(SB),$24-24 // func Yabort(tls *TLS) TEXT ·Yabort(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xabort(SB) @@ -22,6 +27,8 @@ TEXT ·Yabort(SB),$8-8 // func Yabs(tls *TLS, a int32) (r int32) TEXT ·Yabs(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL a+8(FP), AX @@ -33,6 +40,8 @@ TEXT ·Yabs(SB),$24-20 // func Yaccept(tls *TLS, fd int32, addr uintptr, len1 uintptr) (r1 int32) TEXT ·Yaccept(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -48,6 +57,8 @@ TEXT ·Yaccept(SB),$40-36 // func Yaccept4(tls *TLS, fd int32, addr uintptr, len1 uintptr, flg int32) (r1 int32) TEXT ·Yaccept4(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -65,6 +76,8 @@ TEXT ·Yaccept4(SB),$48-44 // func Yaccess(tls *TLS, filename uintptr, amode int32) (r int32) TEXT ·Yaccess(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -78,6 +91,8 @@ TEXT ·Yaccess(SB),$32-28 // func Yacct(tls *TLS, filename uintptr) (r int32) TEXT ·Yacct(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -89,6 +104,8 @@ TEXT ·Yacct(SB),$24-20 // func Yacos(tls *TLS, x float64) (r float64) TEXT ·Yacos(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -100,6 +117,8 @@ TEXT ·Yacos(SB),$24-24 // func Yacosf(tls *TLS, x float32) (r float32) TEXT ·Yacosf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -111,6 +130,8 @@ TEXT ·Yacosf(SB),$24-20 // func Yacosh(tls *TLS, x float64) (r float64) TEXT ·Yacosh(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -122,6 +143,8 @@ TEXT ·Yacosh(SB),$24-24 // func Yacoshf(tls *TLS, x float32) (r float32) TEXT ·Yacoshf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -133,6 +156,8 @@ TEXT ·Yacoshf(SB),$24-20 // func Yacoshl(tls *TLS, x float64) (r float64) TEXT ·Yacoshl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -144,6 +169,8 @@ TEXT ·Yacoshl(SB),$24-24 // func Yacosl(tls *TLS, x float64) (r float64) TEXT ·Yacosl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -155,6 +182,8 @@ TEXT ·Yacosl(SB),$24-24 // func Yaddmntent(tls *TLS, f uintptr, mnt uintptr) (r int32) TEXT ·Yaddmntent(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -168,6 +197,8 @@ TEXT ·Yaddmntent(SB),$32-28 // func Yadjtime(tls *TLS, in uintptr, out uintptr) (r int32) TEXT ·Yadjtime(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ in+8(FP), AX @@ -181,6 +212,8 @@ TEXT ·Yadjtime(SB),$32-28 // func Yadjtimex(tls *TLS, tx uintptr) (r int32) TEXT ·Yadjtimex(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tx+8(FP), AX @@ -192,6 +225,8 @@ TEXT ·Yadjtimex(SB),$24-20 // func Yalarm(tls *TLS, seconds uint32) (r uint32) TEXT ·Yalarm(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL seconds+8(FP), AX @@ -203,6 +238,8 @@ TEXT ·Yalarm(SB),$24-20 // func Yalloca(tls *TLS, size Tsize_t) uintptr TEXT ·Yalloca(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ size+8(FP), AX @@ -214,6 +251,8 @@ TEXT ·Yalloca(SB),$24-24 // func Yalphasort(tls *TLS, a uintptr, b uintptr) (r int32) TEXT ·Yalphasort(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -227,6 +266,8 @@ TEXT ·Yalphasort(SB),$32-28 // func Yarch_prctl(tls *TLS, code int32, addr uint64) (r int32) TEXT ·Yarch_prctl(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL code+8(FP), AX @@ -240,6 +281,8 @@ TEXT ·Yarch_prctl(SB),$32-28 // func Yasctime(tls *TLS, tm uintptr) (r uintptr) TEXT ·Yasctime(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tm+8(FP), AX @@ -251,6 +294,8 @@ TEXT ·Yasctime(SB),$24-24 // func Yasctime_r(tls *TLS, tm uintptr, buf uintptr) (r uintptr) TEXT ·Yasctime_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tm+8(FP), AX @@ -264,6 +309,8 @@ TEXT ·Yasctime_r(SB),$32-32 // func Yasin(tls *TLS, x float64) (r1 float64) TEXT ·Yasin(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -275,6 +322,8 @@ TEXT ·Yasin(SB),$24-24 // func Yasinf(tls *TLS, x float32) (r float32) TEXT ·Yasinf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -286,6 +335,8 @@ TEXT ·Yasinf(SB),$24-20 // func Yasinh(tls *TLS, x3 float64) (r float64) TEXT ·Yasinh(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -297,6 +348,8 @@ TEXT ·Yasinh(SB),$24-24 // func Yasinhf(tls *TLS, x3 float32) (r float32) TEXT ·Yasinhf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -308,6 +361,8 @@ TEXT ·Yasinhf(SB),$24-20 // func Yasinhl(tls *TLS, x float64) (r float64) TEXT ·Yasinhl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -319,6 +374,8 @@ TEXT ·Yasinhl(SB),$24-24 // func Yasinl(tls *TLS, x float64) (r float64) TEXT ·Yasinl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -330,6 +387,8 @@ TEXT ·Yasinl(SB),$24-24 // func Yasprintf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Yasprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -345,6 +404,8 @@ TEXT ·Yasprintf(SB),$40-36 // func Yat_quick_exit(tls *TLS, func1 uintptr) (r1 int32) TEXT ·Yat_quick_exit(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ func1+8(FP), AX @@ -356,6 +417,8 @@ TEXT ·Yat_quick_exit(SB),$24-20 // func Yatan(tls *TLS, x3 float64) (r float64) TEXT ·Yatan(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -367,6 +430,8 @@ TEXT ·Yatan(SB),$24-24 // func Yatan2(tls *TLS, y float64, x float64) (r float64) TEXT ·Yatan2(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ y+8(FP), AX @@ -380,6 +445,8 @@ TEXT ·Yatan2(SB),$32-32 // func Yatan2f(tls *TLS, y float32, x float32) (r float32) TEXT ·Yatan2f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL y+8(FP), AX @@ -393,6 +460,8 @@ TEXT ·Yatan2f(SB),$24-20 // func Yatan2l(tls *TLS, y float64, x float64) (r float64) TEXT ·Yatan2l(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ y+8(FP), AX @@ -406,6 +475,8 @@ TEXT ·Yatan2l(SB),$32-32 // func Yatanf(tls *TLS, x3 float32) (r float32) TEXT ·Yatanf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -417,6 +488,8 @@ TEXT ·Yatanf(SB),$24-20 // func Yatanh(tls *TLS, x3 float64) (r float64) TEXT ·Yatanh(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -428,6 +501,8 @@ TEXT ·Yatanh(SB),$24-24 // func Yatanhf(tls *TLS, x3 float32) (r float32) TEXT ·Yatanhf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -439,6 +514,8 @@ TEXT ·Yatanhf(SB),$24-20 // func Yatanhl(tls *TLS, x float64) (r float64) TEXT ·Yatanhl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -450,6 +527,8 @@ TEXT ·Yatanhl(SB),$24-24 // func Yatanl(tls *TLS, x float64) (r float64) TEXT ·Yatanl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -461,6 +540,8 @@ TEXT ·Yatanl(SB),$24-24 // func Yatexit(tls *TLS, func_ uintptr) (r int32) TEXT ·Yatexit(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ func_+8(FP), AX @@ -472,6 +553,8 @@ TEXT ·Yatexit(SB),$24-20 // func Yatof(tls *TLS, s uintptr) (r float64) TEXT ·Yatof(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -483,6 +566,8 @@ TEXT ·Yatof(SB),$24-24 // func Yatoi(tls *TLS, s uintptr) (r int32) TEXT ·Yatoi(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -494,6 +579,8 @@ TEXT ·Yatoi(SB),$24-20 // func Yatol(tls *TLS, s uintptr) (r int64) TEXT ·Yatol(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -505,6 +592,8 @@ TEXT ·Yatol(SB),$24-24 // func Yatoll(tls *TLS, s uintptr) (r int64) TEXT ·Yatoll(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -516,6 +605,8 @@ TEXT ·Yatoll(SB),$24-24 // func Ybacktrace(t *TLS, buf uintptr, size int32) int32 TEXT ·Ybacktrace(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ buf+8(FP), AX @@ -529,6 +620,8 @@ TEXT ·Ybacktrace(SB),$32-28 // func Ybacktrace_symbols_fd(t *TLS, buffer uintptr, size, fd int32) TEXT ·Ybacktrace_symbols_fd(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ buffer+8(FP), AX @@ -542,6 +635,8 @@ TEXT ·Ybacktrace_symbols_fd(SB),$24-24 // func Ybasename(tls *TLS, s uintptr) (r uintptr) TEXT ·Ybasename(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -553,6 +648,8 @@ TEXT ·Ybasename(SB),$24-24 // func Ybcmp(tls *TLS, s1 uintptr, s2 uintptr, n Tsize_t) (r int32) TEXT ·Ybcmp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s1+8(FP), AX @@ -568,6 +665,8 @@ TEXT ·Ybcmp(SB),$40-36 // func Ybcopy(tls *TLS, s1 uintptr, s2 uintptr, n Tsize_t) TEXT ·Ybcopy(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s1+8(FP), AX @@ -581,6 +680,8 @@ TEXT ·Ybcopy(SB),$32-32 // func Ybind(tls *TLS, fd int32, addr uintptr, len1 Tsocklen_t) (r1 int32) TEXT ·Ybind(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -596,6 +697,8 @@ TEXT ·Ybind(SB),$40-36 // func Ybind_textdomain_codeset(tls *TLS, domainname uintptr, codeset uintptr) (r uintptr) TEXT ·Ybind_textdomain_codeset(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ domainname+8(FP), AX @@ -609,6 +712,8 @@ TEXT ·Ybind_textdomain_codeset(SB),$32-32 // func Ybindtextdomain(tls *TLS, domainname uintptr, dirname uintptr) (r uintptr) TEXT ·Ybindtextdomain(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ domainname+8(FP), AX @@ -622,6 +727,8 @@ TEXT ·Ybindtextdomain(SB),$32-32 // func Ybrk(tls *TLS, end uintptr) (r int32) TEXT ·Ybrk(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ end+8(FP), AX @@ -633,6 +740,8 @@ TEXT ·Ybrk(SB),$24-20 // func Ybsearch(tls *TLS, key uintptr, base uintptr, nel Tsize_t, width Tsize_t, cmp uintptr) (r uintptr) TEXT ·Ybsearch(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -652,6 +761,8 @@ TEXT ·Ybsearch(SB),$56-56 // func Ybtowc(tls *TLS, c int32) (r Twint_t) TEXT ·Ybtowc(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -663,6 +774,8 @@ TEXT ·Ybtowc(SB),$24-20 // func Ybzero(tls *TLS, s uintptr, n Tsize_t) TEXT ·Ybzero(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -674,6 +787,8 @@ TEXT ·Ybzero(SB),$24-24 // func Yc16rtomb(tls *TLS, s uintptr, c16 Tchar16_t, ps uintptr) (r Tsize_t) TEXT ·Yc16rtomb(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -689,6 +804,8 @@ TEXT ·Yc16rtomb(SB),$40-40 // func Yc32rtomb(tls *TLS, s uintptr, c32 Tchar32_t, ps uintptr) (r Tsize_t) TEXT ·Yc32rtomb(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -704,6 +821,8 @@ TEXT ·Yc32rtomb(SB),$40-40 // func Ycabs(tls *TLS, z complex128) (r float64) TEXT ·Ycabs(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -717,6 +836,8 @@ TEXT ·Ycabs(SB),$32-32 // func Ycabsf(tls *TLS, z complex64) (r float32) TEXT ·Ycabsf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -730,6 +851,8 @@ TEXT ·Ycabsf(SB),$24-20 // func Ycabsl(tls *TLS, z complex128) (r float64) TEXT ·Ycabsl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -743,6 +866,8 @@ TEXT ·Ycabsl(SB),$32-32 // func Ycacos(tls *TLS, z complex128) (r complex128) TEXT ·Ycacos(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -758,6 +883,8 @@ TEXT ·Ycacos(SB),$40-40 // func Ycacosf(tls *TLS, z complex64) (r complex64) TEXT ·Ycacosf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -773,6 +900,8 @@ TEXT ·Ycacosf(SB),$24-24 // func Ycacosh(tls *TLS, z complex128) (r complex128) TEXT ·Ycacosh(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -788,6 +917,8 @@ TEXT ·Ycacosh(SB),$40-40 // func Ycacoshf(tls *TLS, z complex64) (r complex64) TEXT ·Ycacoshf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -803,6 +934,8 @@ TEXT ·Ycacoshf(SB),$24-24 // func Ycacoshl(tls *TLS, z complex128) (r complex128) TEXT ·Ycacoshl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -818,6 +951,8 @@ TEXT ·Ycacoshl(SB),$40-40 // func Ycacosl(tls *TLS, z complex128) (r complex128) TEXT ·Ycacosl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -833,6 +968,8 @@ TEXT ·Ycacosl(SB),$40-40 // func Ycalloc(tls *TLS, m Tsize_t, n Tsize_t) (r uintptr) TEXT ·Ycalloc(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ m+8(FP), AX @@ -846,6 +983,8 @@ TEXT ·Ycalloc(SB),$32-32 // func Ycapget(tls *TLS, a uintptr, b uintptr) (r int32) TEXT ·Ycapget(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -859,6 +998,8 @@ TEXT ·Ycapget(SB),$32-28 // func Ycapset(tls *TLS, a uintptr, b uintptr) (r int32) TEXT ·Ycapset(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -872,6 +1013,8 @@ TEXT ·Ycapset(SB),$32-28 // func Ycarg(tls *TLS, z complex128) (r float64) TEXT ·Ycarg(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -885,6 +1028,8 @@ TEXT ·Ycarg(SB),$32-32 // func Ycargf(tls *TLS, z complex64) (r float32) TEXT ·Ycargf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -898,6 +1043,8 @@ TEXT ·Ycargf(SB),$24-20 // func Ycargl(tls *TLS, z complex128) (r float64) TEXT ·Ycargl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -911,6 +1058,8 @@ TEXT ·Ycargl(SB),$32-32 // func Ycasin(tls *TLS, z complex128) (r1 complex128) TEXT ·Ycasin(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -926,6 +1075,8 @@ TEXT ·Ycasin(SB),$40-40 // func Ycasinf(tls *TLS, z complex64) (r1 complex64) TEXT ·Ycasinf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -941,6 +1092,8 @@ TEXT ·Ycasinf(SB),$24-24 // func Ycasinh(tls *TLS, z complex128) (r complex128) TEXT ·Ycasinh(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -956,6 +1109,8 @@ TEXT ·Ycasinh(SB),$40-40 // func Ycasinhf(tls *TLS, z complex64) (r complex64) TEXT ·Ycasinhf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -971,6 +1126,8 @@ TEXT ·Ycasinhf(SB),$24-24 // func Ycasinhl(tls *TLS, z complex128) (r complex128) TEXT ·Ycasinhl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -986,6 +1143,8 @@ TEXT ·Ycasinhl(SB),$40-40 // func Ycasinl(tls *TLS, z complex128) (r complex128) TEXT ·Ycasinl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1001,6 +1160,8 @@ TEXT ·Ycasinl(SB),$40-40 // func Ycatan(tls *TLS, z complex128) (r complex128) TEXT ·Ycatan(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1016,6 +1177,8 @@ TEXT ·Ycatan(SB),$40-40 // func Ycatanf(tls *TLS, z complex64) (r complex64) TEXT ·Ycatanf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1031,6 +1194,8 @@ TEXT ·Ycatanf(SB),$24-24 // func Ycatanh(tls *TLS, z complex128) (r complex128) TEXT ·Ycatanh(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1046,6 +1211,8 @@ TEXT ·Ycatanh(SB),$40-40 // func Ycatanhf(tls *TLS, z complex64) (r complex64) TEXT ·Ycatanhf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1061,6 +1228,8 @@ TEXT ·Ycatanhf(SB),$24-24 // func Ycatanhl(tls *TLS, z complex128) (r complex128) TEXT ·Ycatanhl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1076,6 +1245,8 @@ TEXT ·Ycatanhl(SB),$40-40 // func Ycatanl(tls *TLS, z complex128) (r complex128) TEXT ·Ycatanl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1091,6 +1262,8 @@ TEXT ·Ycatanl(SB),$40-40 // func Ycatclose(tls *TLS, catd Tnl_catd) (r int32) TEXT ·Ycatclose(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ catd+8(FP), AX @@ -1102,6 +1275,8 @@ TEXT ·Ycatclose(SB),$24-20 // func Ycatgets(tls *TLS, catd Tnl_catd, set_id int32, msg_id int32, s uintptr) (r uintptr) TEXT ·Ycatgets(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ catd+8(FP), AX @@ -1119,6 +1294,8 @@ TEXT ·Ycatgets(SB),$40-40 // func Ycatopen(tls *TLS, name uintptr, oflag int32) (r Tnl_catd) TEXT ·Ycatopen(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -1132,6 +1309,8 @@ TEXT ·Ycatopen(SB),$32-32 // func Ycbrt(tls *TLS, x float64) (r1 float64) TEXT ·Ycbrt(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -1143,6 +1322,8 @@ TEXT ·Ycbrt(SB),$24-24 // func Ycbrtf(tls *TLS, x float32) (r1 float32) TEXT ·Ycbrtf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -1154,6 +1335,8 @@ TEXT ·Ycbrtf(SB),$24-20 // func Ycbrtl(tls *TLS, x float64) (r float64) TEXT ·Ycbrtl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -1165,6 +1348,8 @@ TEXT ·Ycbrtl(SB),$24-24 // func Yccos(tls *TLS, z complex128) (r complex128) TEXT ·Yccos(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1180,6 +1365,8 @@ TEXT ·Yccos(SB),$40-40 // func Yccosf(tls *TLS, z complex64) (r complex64) TEXT ·Yccosf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1195,6 +1382,8 @@ TEXT ·Yccosf(SB),$24-24 // func Yccosh(tls *TLS, z complex128) (r complex128) TEXT ·Yccosh(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1210,6 +1399,8 @@ TEXT ·Yccosh(SB),$40-40 // func Yccoshf(tls *TLS, z complex64) (r complex64) TEXT ·Yccoshf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1225,6 +1416,8 @@ TEXT ·Yccoshf(SB),$24-24 // func Yccoshl(tls *TLS, z complex128) (r complex128) TEXT ·Yccoshl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1240,6 +1433,8 @@ TEXT ·Yccoshl(SB),$40-40 // func Yccosl(tls *TLS, z complex128) (r complex128) TEXT ·Yccosl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1255,6 +1450,8 @@ TEXT ·Yccosl(SB),$40-40 // func Yceil(tls *TLS, x3 float64) (r float64) TEXT ·Yceil(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -1266,6 +1463,8 @@ TEXT ·Yceil(SB),$24-24 // func Yceilf(tls *TLS, x3 float32) (r float32) TEXT ·Yceilf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -1277,6 +1476,8 @@ TEXT ·Yceilf(SB),$24-20 // func Yceill(tls *TLS, x float64) (r float64) TEXT ·Yceill(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -1288,6 +1489,8 @@ TEXT ·Yceill(SB),$24-24 // func Ycexp(tls *TLS, z complex128) (r complex128) TEXT ·Ycexp(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1303,6 +1506,8 @@ TEXT ·Ycexp(SB),$40-40 // func Ycexpf(tls *TLS, z complex64) (r complex64) TEXT ·Ycexpf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1318,6 +1523,8 @@ TEXT ·Ycexpf(SB),$24-24 // func Ycexpl(tls *TLS, z complex128) (r complex128) TEXT ·Ycexpl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1333,6 +1540,8 @@ TEXT ·Ycexpl(SB),$40-40 // func Ycfgetispeed(tls *TLS, tio uintptr) (r Tspeed_t) TEXT ·Ycfgetispeed(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tio+8(FP), AX @@ -1344,6 +1553,8 @@ TEXT ·Ycfgetispeed(SB),$24-20 // func Ycfgetospeed(tls *TLS, tio uintptr) (r Tspeed_t) TEXT ·Ycfgetospeed(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tio+8(FP), AX @@ -1355,6 +1566,8 @@ TEXT ·Ycfgetospeed(SB),$24-20 // func Ycfmakeraw(tls *TLS, t uintptr) TEXT ·Ycfmakeraw(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -1364,6 +1577,8 @@ TEXT ·Ycfmakeraw(SB),$16-16 // func Ycfsetispeed(tls *TLS, tio uintptr, speed Tspeed_t) (r int32) TEXT ·Ycfsetispeed(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tio+8(FP), AX @@ -1377,6 +1592,8 @@ TEXT ·Ycfsetispeed(SB),$32-28 // func Ycfsetospeed(tls *TLS, tio uintptr, speed Tspeed_t) (r int32) TEXT ·Ycfsetospeed(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tio+8(FP), AX @@ -1390,6 +1607,8 @@ TEXT ·Ycfsetospeed(SB),$32-28 // func Ycfsetspeed(tls *TLS, tio uintptr, speed Tspeed_t) (r int32) TEXT ·Ycfsetspeed(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tio+8(FP), AX @@ -1403,6 +1622,8 @@ TEXT ·Ycfsetspeed(SB),$32-28 // func Ychdir(tls *TLS, path uintptr) (r int32) TEXT ·Ychdir(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -1414,6 +1635,8 @@ TEXT ·Ychdir(SB),$24-20 // func Ychmod(tls *TLS, path uintptr, mode Tmode_t) (r int32) TEXT ·Ychmod(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -1427,6 +1650,8 @@ TEXT ·Ychmod(SB),$32-28 // func Ychown(tls *TLS, path uintptr, uid Tuid_t, gid Tgid_t) (r int32) TEXT ·Ychown(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -1442,6 +1667,8 @@ TEXT ·Ychown(SB),$32-28 // func Ychroot(tls *TLS, path uintptr) (r int32) TEXT ·Ychroot(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -1453,6 +1680,8 @@ TEXT ·Ychroot(SB),$24-20 // func Ycimag(tls *TLS, z complex128) (r float64) TEXT ·Ycimag(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1466,6 +1695,8 @@ TEXT ·Ycimag(SB),$32-32 // func Ycimagf(tls *TLS, z complex64) (r float32) TEXT ·Ycimagf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1479,6 +1710,8 @@ TEXT ·Ycimagf(SB),$24-20 // func Ycimagl(tls *TLS, z complex128) (r float64) TEXT ·Ycimagl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1492,6 +1725,8 @@ TEXT ·Ycimagl(SB),$32-32 // func Yclearenv(tls *TLS) (r int32) TEXT ·Yclearenv(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xclearenv(SB) @@ -1501,6 +1736,8 @@ TEXT ·Yclearenv(SB),$16-12 // func Yclearerr(tls *TLS, f uintptr) TEXT ·Yclearerr(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -1510,6 +1747,8 @@ TEXT ·Yclearerr(SB),$16-16 // func Yclearerr_unlocked(tls *TLS, f uintptr) TEXT ·Yclearerr_unlocked(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -1519,6 +1758,8 @@ TEXT ·Yclearerr_unlocked(SB),$16-16 // func Yclock(tls *TLS) (r Tclock_t) TEXT ·Yclock(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xclock(SB) @@ -1528,6 +1769,8 @@ TEXT ·Yclock(SB),$16-16 // func Yclock_adjtime(tls *TLS, clock_id Tclockid_t, utx uintptr) (r1 int32) TEXT ·Yclock_adjtime(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL clock_id+8(FP), AX @@ -1541,6 +1784,8 @@ TEXT ·Yclock_adjtime(SB),$32-28 // func Yclock_getcpuclockid(tls *TLS, pid Tpid_t, clk uintptr) (r int32) TEXT ·Yclock_getcpuclockid(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -1554,6 +1799,8 @@ TEXT ·Yclock_getcpuclockid(SB),$32-28 // func Yclock_getres(tls *TLS, clk Tclockid_t, ts uintptr) (r int32) TEXT ·Yclock_getres(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL clk+8(FP), AX @@ -1567,6 +1814,8 @@ TEXT ·Yclock_getres(SB),$32-28 // func Yclock_gettime(tls *TLS, clk Tclockid_t, ts uintptr) (r int32) TEXT ·Yclock_gettime(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL clk+8(FP), AX @@ -1580,6 +1829,8 @@ TEXT ·Yclock_gettime(SB),$32-28 // func Yclock_nanosleep(tls *TLS, clk Tclockid_t, flags int32, req uintptr, rem uintptr) (r int32) TEXT ·Yclock_nanosleep(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL clk+8(FP), AX @@ -1597,6 +1848,8 @@ TEXT ·Yclock_nanosleep(SB),$40-36 // func Yclock_settime(tls *TLS, clk Tclockid_t, ts uintptr) (r int32) TEXT ·Yclock_settime(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL clk+8(FP), AX @@ -1610,6 +1863,8 @@ TEXT ·Yclock_settime(SB),$32-28 // func Yclog(tls *TLS, z complex128) (r1 complex128) TEXT ·Yclog(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1625,6 +1880,8 @@ TEXT ·Yclog(SB),$40-40 // func Yclogf(tls *TLS, z complex64) (r1 complex64) TEXT ·Yclogf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1640,6 +1897,8 @@ TEXT ·Yclogf(SB),$24-24 // func Yclogl(tls *TLS, z complex128) (r complex128) TEXT ·Yclogl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1655,6 +1914,8 @@ TEXT ·Yclogl(SB),$40-40 // func Yclose(tls *TLS, fd int32) (r1 int32) TEXT ·Yclose(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -1666,6 +1927,8 @@ TEXT ·Yclose(SB),$24-20 // func Yclosedir(tls *TLS, dir uintptr) (r int32) TEXT ·Yclosedir(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -1677,6 +1940,8 @@ TEXT ·Yclosedir(SB),$24-20 // func Ycloselog(tls *TLS) TEXT ·Ycloselog(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xcloselog(SB) @@ -1684,6 +1949,8 @@ TEXT ·Ycloselog(SB),$8-8 // func Yconfstr(tls *TLS, name int32, buf uintptr, len1 Tsize_t) (r Tsize_t) TEXT ·Yconfstr(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL name+8(FP), AX @@ -1699,6 +1966,8 @@ TEXT ·Yconfstr(SB),$40-40 // func Yconj(tls *TLS, z complex128) (r complex128) TEXT ·Yconj(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1714,6 +1983,8 @@ TEXT ·Yconj(SB),$40-40 // func Yconjf(tls *TLS, z complex64) (r complex64) TEXT ·Yconjf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1729,6 +2000,8 @@ TEXT ·Yconjf(SB),$24-24 // func Yconjl(tls *TLS, z complex128) (r complex128) TEXT ·Yconjl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1744,6 +2017,8 @@ TEXT ·Yconjl(SB),$40-40 // func Yconnect(tls *TLS, fd int32, addr uintptr, len1 Tsocklen_t) (r1 int32) TEXT ·Yconnect(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -1759,6 +2034,8 @@ TEXT ·Yconnect(SB),$40-36 // func Ycopy_file_range(tls *TLS, fd_in int32, off_in uintptr, fd_out int32, off_out uintptr, len1 Tsize_t, flags uint32) (r Tssize_t) TEXT ·Ycopy_file_range(SB),$64-64 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd_in+8(FP), AX @@ -1780,6 +2057,8 @@ TEXT ·Ycopy_file_range(SB),$64-64 // func Ycopysign(tls *TLS, x float64, y float64) (r float64) TEXT ·Ycopysign(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -1793,6 +2072,8 @@ TEXT ·Ycopysign(SB),$32-32 // func Ycopysignf(tls *TLS, x float32, y float32) (r float32) TEXT ·Ycopysignf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -1806,6 +2087,8 @@ TEXT ·Ycopysignf(SB),$24-20 // func Ycopysignl(tls *TLS, x float64, y float64) (r float64) TEXT ·Ycopysignl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -1819,6 +2102,8 @@ TEXT ·Ycopysignl(SB),$32-32 // func Ycos(tls *TLS, x3 float64) (r float64) TEXT ·Ycos(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -1830,6 +2115,8 @@ TEXT ·Ycos(SB),$24-24 // func Ycosf(tls *TLS, x3 float32) (r float32) TEXT ·Ycosf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -1841,6 +2128,8 @@ TEXT ·Ycosf(SB),$24-20 // func Ycosh(tls *TLS, x3 float64) (r float64) TEXT ·Ycosh(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -1852,6 +2141,8 @@ TEXT ·Ycosh(SB),$24-24 // func Ycoshf(tls *TLS, x3 float32) (r float32) TEXT ·Ycoshf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -1863,6 +2154,8 @@ TEXT ·Ycoshf(SB),$24-20 // func Ycoshl(tls *TLS, x float64) (r float64) TEXT ·Ycoshl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -1874,6 +2167,8 @@ TEXT ·Ycoshl(SB),$24-24 // func Ycosl(tls *TLS, x float64) (r float64) TEXT ·Ycosl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -1885,6 +2180,8 @@ TEXT ·Ycosl(SB),$24-24 // func Ycpow(tls *TLS, z complex128, c complex128) (r complex128) TEXT ·Ycpow(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1904,6 +2201,8 @@ TEXT ·Ycpow(SB),$56-56 // func Ycpowf(tls *TLS, z complex64, c complex64) (r complex64) TEXT ·Ycpowf(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1923,6 +2222,8 @@ TEXT ·Ycpowf(SB),$32-32 // func Ycpowl(tls *TLS, z complex128, c complex128) (r complex128) TEXT ·Ycpowl(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1942,6 +2243,8 @@ TEXT ·Ycpowl(SB),$56-56 // func Ycproj(tls *TLS, z complex128) (r complex128) TEXT ·Ycproj(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1957,6 +2260,8 @@ TEXT ·Ycproj(SB),$40-40 // func Ycprojf(tls *TLS, z complex64) (r complex64) TEXT ·Ycprojf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -1972,6 +2277,8 @@ TEXT ·Ycprojf(SB),$24-24 // func Ycprojl(tls *TLS, z complex128) (r complex128) TEXT ·Ycprojl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -1987,6 +2294,8 @@ TEXT ·Ycprojl(SB),$40-40 // func Ycreal(tls *TLS, z complex128) (r float64) TEXT ·Ycreal(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2000,6 +2309,8 @@ TEXT ·Ycreal(SB),$32-32 // func Ycrealf(tls *TLS, z complex64) (r float32) TEXT ·Ycrealf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -2013,6 +2324,8 @@ TEXT ·Ycrealf(SB),$24-20 // func Ycreall(tls *TLS, z complex128) (r float64) TEXT ·Ycreall(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2026,6 +2339,8 @@ TEXT ·Ycreall(SB),$32-32 // func Ycreat(tls *TLS, filename uintptr, mode Tmode_t) (r int32) TEXT ·Ycreat(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -2039,6 +2354,8 @@ TEXT ·Ycreat(SB),$32-28 // func Ycrypt(tls *TLS, key uintptr, salt uintptr) (r uintptr) TEXT ·Ycrypt(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -2052,6 +2369,8 @@ TEXT ·Ycrypt(SB),$32-32 // func Ycrypt_r(tls *TLS, key uintptr, salt uintptr, data uintptr) (r uintptr) TEXT ·Ycrypt_r(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -2067,6 +2386,8 @@ TEXT ·Ycrypt_r(SB),$40-40 // func Ycsin(tls *TLS, z complex128) (r complex128) TEXT ·Ycsin(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2082,6 +2403,8 @@ TEXT ·Ycsin(SB),$40-40 // func Ycsinf(tls *TLS, z complex64) (r complex64) TEXT ·Ycsinf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -2097,6 +2420,8 @@ TEXT ·Ycsinf(SB),$24-24 // func Ycsinh(tls *TLS, z complex128) (r complex128) TEXT ·Ycsinh(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2112,6 +2437,8 @@ TEXT ·Ycsinh(SB),$40-40 // func Ycsinhf(tls *TLS, z complex64) (r complex64) TEXT ·Ycsinhf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -2127,6 +2454,8 @@ TEXT ·Ycsinhf(SB),$24-24 // func Ycsinhl(tls *TLS, z complex128) (r complex128) TEXT ·Ycsinhl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2142,6 +2471,8 @@ TEXT ·Ycsinhl(SB),$40-40 // func Ycsinl(tls *TLS, z complex128) (r complex128) TEXT ·Ycsinl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2157,6 +2488,8 @@ TEXT ·Ycsinl(SB),$40-40 // func Ycsqrt(tls *TLS, z complex128) (r complex128) TEXT ·Ycsqrt(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2172,6 +2505,8 @@ TEXT ·Ycsqrt(SB),$40-40 // func Ycsqrtf(tls *TLS, z complex64) (r complex64) TEXT ·Ycsqrtf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -2187,6 +2522,8 @@ TEXT ·Ycsqrtf(SB),$24-24 // func Ycsqrtl(tls *TLS, z complex128) (r complex128) TEXT ·Ycsqrtl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2202,6 +2539,8 @@ TEXT ·Ycsqrtl(SB),$40-40 // func Yctan(tls *TLS, z complex128) (r complex128) TEXT ·Yctan(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2217,6 +2556,8 @@ TEXT ·Yctan(SB),$40-40 // func Yctanf(tls *TLS, z complex64) (r complex64) TEXT ·Yctanf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -2232,6 +2573,8 @@ TEXT ·Yctanf(SB),$24-24 // func Yctanh(tls *TLS, z complex128) (r complex128) TEXT ·Yctanh(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2247,6 +2590,8 @@ TEXT ·Yctanh(SB),$40-40 // func Yctanhf(tls *TLS, z complex64) (r complex64) TEXT ·Yctanhf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL z_real+8(FP), AX @@ -2262,6 +2607,8 @@ TEXT ·Yctanhf(SB),$24-24 // func Yctanhl(tls *TLS, z complex128) (r complex128) TEXT ·Yctanhl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2277,6 +2624,8 @@ TEXT ·Yctanhl(SB),$40-40 // func Yctanl(tls *TLS, z complex128) (r complex128) TEXT ·Yctanl(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ z_real+8(FP), AX @@ -2292,6 +2641,8 @@ TEXT ·Yctanl(SB),$40-40 // func Yctermid(tls *TLS, s uintptr) (r uintptr) TEXT ·Yctermid(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -2303,6 +2654,8 @@ TEXT ·Yctermid(SB),$24-24 // func Yctime(tls *TLS, t uintptr) (r uintptr) TEXT ·Yctime(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -2314,6 +2667,8 @@ TEXT ·Yctime(SB),$24-24 // func Yctime_r(tls *TLS, t uintptr, buf uintptr) (r uintptr) TEXT ·Yctime_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -2327,6 +2682,8 @@ TEXT ·Yctime_r(SB),$32-32 // func Ycuserid(tls *TLS, buf uintptr) (r uintptr) TEXT ·Ycuserid(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ buf+8(FP), AX @@ -2338,6 +2695,8 @@ TEXT ·Ycuserid(SB),$24-24 // func Ydcgettext(tls *TLS, domainname uintptr, msgid uintptr, category int32) (r uintptr) TEXT ·Ydcgettext(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ domainname+8(FP), AX @@ -2353,6 +2712,8 @@ TEXT ·Ydcgettext(SB),$40-40 // func Ydcngettext(tls *TLS, domainname uintptr, msgid1 uintptr, msgid2 uintptr, n uint64, category int32) (r1 uintptr) TEXT ·Ydcngettext(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ domainname+8(FP), AX @@ -2372,6 +2733,8 @@ TEXT ·Ydcngettext(SB),$56-56 // func Ydelete_module(tls *TLS, a uintptr, b uint32) (r int32) TEXT ·Ydelete_module(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -2385,6 +2748,8 @@ TEXT ·Ydelete_module(SB),$32-28 // func Ydgettext(tls *TLS, domainname uintptr, msgid uintptr) (r uintptr) TEXT ·Ydgettext(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ domainname+8(FP), AX @@ -2398,6 +2763,8 @@ TEXT ·Ydgettext(SB),$32-32 // func Ydifftime(tls *TLS, t1 Ttime_t, t0 Ttime_t) (r float64) TEXT ·Ydifftime(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t1+8(FP), AX @@ -2411,6 +2778,8 @@ TEXT ·Ydifftime(SB),$32-32 // func Ydirfd(tls *TLS, d uintptr) (r int32) TEXT ·Ydirfd(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -2422,6 +2791,8 @@ TEXT ·Ydirfd(SB),$24-20 // func Ydirname(tls *TLS, s uintptr) (r uintptr) TEXT ·Ydirname(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -2433,6 +2804,8 @@ TEXT ·Ydirname(SB),$24-24 // func Ydiv(tls *TLS, num int32, den int32) (r Tdiv_t) TEXT ·Ydiv(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL num+8(FP), AX @@ -2448,6 +2821,8 @@ TEXT ·Ydiv(SB),$24-24 // func Ydlclose(t *TLS, handle uintptr) int32 TEXT ·Ydlclose(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ handle+8(FP), AX @@ -2459,6 +2834,8 @@ TEXT ·Ydlclose(SB),$24-20 // func Ydlerror(t *TLS) uintptr TEXT ·Ydlerror(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) CALL ·Xdlerror(SB) @@ -2468,6 +2845,8 @@ TEXT ·Ydlerror(SB),$16-16 // func Ydlopen(t *TLS, filename uintptr, flags int32) uintptr TEXT ·Ydlopen(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -2481,6 +2860,8 @@ TEXT ·Ydlopen(SB),$32-32 // func Ydlsym(t *TLS, handle, symbol uintptr) uintptr TEXT ·Ydlsym(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ handle+8(FP), AX @@ -2494,6 +2875,8 @@ TEXT ·Ydlsym(SB),$32-32 // func Ydn_comp(tls *TLS, src uintptr, dst uintptr, space int32, dnptrs uintptr, lastdnptr uintptr) (r int32) TEXT ·Ydn_comp(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ src+8(FP), AX @@ -2513,6 +2896,8 @@ TEXT ·Ydn_comp(SB),$56-52 // func Ydn_expand(tls *TLS, base uintptr, end uintptr, src uintptr, dest uintptr, space int32) (r int32) TEXT ·Ydn_expand(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ base+8(FP), AX @@ -2532,6 +2917,8 @@ TEXT ·Ydn_expand(SB),$56-52 // func Ydn_skipname(tls *TLS, s uintptr, end uintptr) (r int32) TEXT ·Ydn_skipname(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -2545,6 +2932,8 @@ TEXT ·Ydn_skipname(SB),$32-28 // func Ydngettext(tls *TLS, domainname uintptr, msgid1 uintptr, msgid2 uintptr, n uint64) (r uintptr) TEXT ·Ydngettext(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ domainname+8(FP), AX @@ -2562,6 +2951,8 @@ TEXT ·Ydngettext(SB),$48-48 // func Ydprintf(tls *TLS, fd int32, fmt uintptr, va uintptr) (r int32) TEXT ·Ydprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -2577,6 +2968,8 @@ TEXT ·Ydprintf(SB),$40-36 // func Ydrand48(tls *TLS) (r float64) TEXT ·Ydrand48(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xdrand48(SB) @@ -2586,6 +2979,8 @@ TEXT ·Ydrand48(SB),$16-16 // func Ydrem(tls *TLS, x float64, y float64) (r float64) TEXT ·Ydrem(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2599,6 +2994,8 @@ TEXT ·Ydrem(SB),$32-32 // func Ydremf(tls *TLS, x float32, y float32) (r float32) TEXT ·Ydremf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -2612,6 +3009,8 @@ TEXT ·Ydremf(SB),$24-20 // func Ydup(tls *TLS, fd int32) (r int32) TEXT ·Ydup(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -2623,6 +3022,8 @@ TEXT ·Ydup(SB),$24-20 // func Ydup2(tls *TLS, old int32, new1 int32) (r1 int32) TEXT ·Ydup2(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL old+8(FP), AX @@ -2636,6 +3037,8 @@ TEXT ·Ydup2(SB),$24-20 // func Ydup3(tls *TLS, old int32, new1 int32, flags int32) (r int32) TEXT ·Ydup3(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL old+8(FP), AX @@ -2651,6 +3054,8 @@ TEXT ·Ydup3(SB),$32-28 // func Yduplocale(tls *TLS, old Tlocale_t) (r Tlocale_t) TEXT ·Yduplocale(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ old+8(FP), AX @@ -2662,6 +3067,8 @@ TEXT ·Yduplocale(SB),$24-24 // func Yeaccess(tls *TLS, filename uintptr, amode int32) (r int32) TEXT ·Yeaccess(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -2675,6 +3082,8 @@ TEXT ·Yeaccess(SB),$32-28 // func Yecvt(tls *TLS, x float64, n int32, dp uintptr, sign uintptr) (r uintptr) TEXT ·Yecvt(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2692,6 +3101,8 @@ TEXT ·Yecvt(SB),$48-48 // func Yencrypt(tls *TLS, block uintptr, edflag int32) TEXT ·Yencrypt(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ block+8(FP), AX @@ -2703,6 +3114,8 @@ TEXT ·Yencrypt(SB),$24-20 // func Yendgrent(tls *TLS) TEXT ·Yendgrent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendgrent(SB) @@ -2710,6 +3123,8 @@ TEXT ·Yendgrent(SB),$8-8 // func Yendhostent(tls *TLS) TEXT ·Yendhostent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendhostent(SB) @@ -2717,6 +3132,8 @@ TEXT ·Yendhostent(SB),$8-8 // func Yendmntent(tls *TLS, f uintptr) (r int32) TEXT ·Yendmntent(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -2728,6 +3145,8 @@ TEXT ·Yendmntent(SB),$24-20 // func Yendnetent(tls *TLS) TEXT ·Yendnetent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendnetent(SB) @@ -2735,6 +3154,8 @@ TEXT ·Yendnetent(SB),$8-8 // func Yendprotoent(tls *TLS) TEXT ·Yendprotoent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendprotoent(SB) @@ -2742,6 +3163,8 @@ TEXT ·Yendprotoent(SB),$8-8 // func Yendpwent(tls *TLS) TEXT ·Yendpwent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendpwent(SB) @@ -2749,6 +3172,8 @@ TEXT ·Yendpwent(SB),$8-8 // func Yendservent(tls *TLS) TEXT ·Yendservent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendservent(SB) @@ -2756,6 +3181,8 @@ TEXT ·Yendservent(SB),$8-8 // func Yendspent(tls *TLS) TEXT ·Yendspent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendspent(SB) @@ -2763,6 +3190,8 @@ TEXT ·Yendspent(SB),$8-8 // func Yendusershell(tls *TLS) TEXT ·Yendusershell(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendusershell(SB) @@ -2770,6 +3199,8 @@ TEXT ·Yendusershell(SB),$8-8 // func Yendutent(tls *TLS) TEXT ·Yendutent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendutent(SB) @@ -2777,6 +3208,8 @@ TEXT ·Yendutent(SB),$8-8 // func Yendutxent(tls *TLS) TEXT ·Yendutxent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xendutxent(SB) @@ -2784,6 +3217,8 @@ TEXT ·Yendutxent(SB),$8-8 // func Yepoll_create(tls *TLS, size int32) (r int32) TEXT ·Yepoll_create(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL size+8(FP), AX @@ -2795,6 +3230,8 @@ TEXT ·Yepoll_create(SB),$24-20 // func Yepoll_create1(tls *TLS, flags int32) (r1 int32) TEXT ·Yepoll_create1(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL flags+8(FP), AX @@ -2806,6 +3243,8 @@ TEXT ·Yepoll_create1(SB),$24-20 // func Yepoll_ctl(tls *TLS, fd int32, op int32, fd2 int32, ev uintptr) (r int32) TEXT ·Yepoll_ctl(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -2823,6 +3262,8 @@ TEXT ·Yepoll_ctl(SB),$40-36 // func Yepoll_pwait(tls *TLS, fd int32, ev uintptr, cnt int32, to int32, sigs uintptr) (r1 int32) TEXT ·Yepoll_pwait(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -2842,6 +3283,8 @@ TEXT ·Yepoll_pwait(SB),$48-44 // func Yepoll_wait(tls *TLS, fd int32, ev uintptr, cnt int32, to int32) (r int32) TEXT ·Yepoll_wait(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -2859,6 +3302,8 @@ TEXT ·Yepoll_wait(SB),$40-36 // func Yerand48(tls *TLS, s uintptr) (r float64) TEXT ·Yerand48(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -2870,6 +3315,8 @@ TEXT ·Yerand48(SB),$24-24 // func Yerf(tls *TLS, x float64) (r1 float64) TEXT ·Yerf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2881,6 +3328,8 @@ TEXT ·Yerf(SB),$24-24 // func Yerfc(tls *TLS, x float64) (r1 float64) TEXT ·Yerfc(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2892,6 +3341,8 @@ TEXT ·Yerfc(SB),$24-24 // func Yerfcf(tls *TLS, x float32) (r1 float32) TEXT ·Yerfcf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -2903,6 +3354,8 @@ TEXT ·Yerfcf(SB),$24-20 // func Yerfcl(tls *TLS, x float64) (r float64) TEXT ·Yerfcl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2914,6 +3367,8 @@ TEXT ·Yerfcl(SB),$24-24 // func Yerff(tls *TLS, x float32) (r1 float32) TEXT ·Yerff(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -2925,6 +3380,8 @@ TEXT ·Yerff(SB),$24-20 // func Yerfl(tls *TLS, x float64) (r float64) TEXT ·Yerfl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2936,6 +3393,8 @@ TEXT ·Yerfl(SB),$24-24 // func Yerr(tls *TLS, status int32, fmt uintptr, va uintptr) TEXT ·Yerr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL status+8(FP), AX @@ -2949,6 +3408,8 @@ TEXT ·Yerr(SB),$32-32 // func Yerrx(tls *TLS, status int32, fmt uintptr, va uintptr) TEXT ·Yerrx(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL status+8(FP), AX @@ -2962,6 +3423,8 @@ TEXT ·Yerrx(SB),$32-32 // func Yether_aton(tls *TLS, x uintptr) (r uintptr) TEXT ·Yether_aton(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2973,6 +3436,8 @@ TEXT ·Yether_aton(SB),$24-24 // func Yether_aton_r(tls *TLS, x uintptr, p_a uintptr) (r uintptr) TEXT ·Yether_aton_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -2986,6 +3451,8 @@ TEXT ·Yether_aton_r(SB),$32-32 // func Yether_hostton(tls *TLS, hostname uintptr, e uintptr) (r int32) TEXT ·Yether_hostton(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ hostname+8(FP), AX @@ -2999,6 +3466,8 @@ TEXT ·Yether_hostton(SB),$32-28 // func Yether_line(tls *TLS, l uintptr, e uintptr, hostname uintptr) (r int32) TEXT ·Yether_line(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -3014,6 +3483,8 @@ TEXT ·Yether_line(SB),$40-36 // func Yether_ntoa(tls *TLS, p_a uintptr) (r uintptr) TEXT ·Yether_ntoa(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p_a+8(FP), AX @@ -3025,6 +3496,8 @@ TEXT ·Yether_ntoa(SB),$24-24 // func Yether_ntoa_r(tls *TLS, p_a uintptr, x uintptr) (r uintptr) TEXT ·Yether_ntoa_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p_a+8(FP), AX @@ -3038,6 +3511,8 @@ TEXT ·Yether_ntoa_r(SB),$32-32 // func Yether_ntohost(tls *TLS, hostname uintptr, e uintptr) (r int32) TEXT ·Yether_ntohost(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ hostname+8(FP), AX @@ -3051,6 +3526,8 @@ TEXT ·Yether_ntohost(SB),$32-28 // func Yeuidaccess(tls *TLS, filename uintptr, amode int32) (r int32) TEXT ·Yeuidaccess(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -3064,6 +3541,8 @@ TEXT ·Yeuidaccess(SB),$32-28 // func Yeventfd(tls *TLS, count uint32, flags int32) (r1 int32) TEXT ·Yeventfd(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL count+8(FP), AX @@ -3077,6 +3556,8 @@ TEXT ·Yeventfd(SB),$24-20 // func Yeventfd_read(tls *TLS, fd int32, value uintptr) (r int32) TEXT ·Yeventfd_read(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3090,6 +3571,8 @@ TEXT ·Yeventfd_read(SB),$32-28 // func Yeventfd_write(tls *TLS, fd int32, _value Teventfd_t) (r int32) TEXT ·Yeventfd_write(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3103,6 +3586,8 @@ TEXT ·Yeventfd_write(SB),$32-28 // func Yexecl(tls *TLS, path uintptr, argv0 uintptr, va uintptr) (r int32) TEXT ·Yexecl(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -3118,6 +3603,8 @@ TEXT ·Yexecl(SB),$40-36 // func Yexecle(tls *TLS, path uintptr, argv0 uintptr, va uintptr) (r int32) TEXT ·Yexecle(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -3133,6 +3620,8 @@ TEXT ·Yexecle(SB),$40-36 // func Yexeclp(tls *TLS, file uintptr, argv0 uintptr, va uintptr) (r int32) TEXT ·Yexeclp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ file+8(FP), AX @@ -3148,6 +3637,8 @@ TEXT ·Yexeclp(SB),$40-36 // func Yexecv(tls *TLS, path uintptr, argv uintptr) (r int32) TEXT ·Yexecv(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -3161,6 +3652,8 @@ TEXT ·Yexecv(SB),$32-28 // func Yexecve(tls *TLS, path uintptr, argv uintptr, envp uintptr) (r int32) TEXT ·Yexecve(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -3176,6 +3669,8 @@ TEXT ·Yexecve(SB),$40-36 // func Yexecvp(tls *TLS, file uintptr, argv uintptr) (r int32) TEXT ·Yexecvp(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ file+8(FP), AX @@ -3189,6 +3684,8 @@ TEXT ·Yexecvp(SB),$32-28 // func Yexecvpe(tls *TLS, file uintptr, argv uintptr, envp uintptr) (r int32) TEXT ·Yexecvpe(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ file+8(FP), AX @@ -3204,6 +3701,8 @@ TEXT ·Yexecvpe(SB),$40-36 // func Yexit(tls *TLS, code int32) TEXT ·Yexit(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL code+8(FP), AX @@ -3213,6 +3712,8 @@ TEXT ·Yexit(SB),$16-12 // func Yexp(tls *TLS, x1 float64) (r1 float64) TEXT ·Yexp(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x1+8(FP), AX @@ -3224,6 +3725,8 @@ TEXT ·Yexp(SB),$24-24 // func Yexp10(tls *TLS, x float64) (r float64) TEXT ·Yexp10(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3235,6 +3738,8 @@ TEXT ·Yexp10(SB),$24-24 // func Yexp10f(tls *TLS, x float32) (r float32) TEXT ·Yexp10f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -3246,6 +3751,8 @@ TEXT ·Yexp10f(SB),$24-20 // func Yexp10l(tls *TLS, x float64) (r float64) TEXT ·Yexp10l(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3257,6 +3764,8 @@ TEXT ·Yexp10l(SB),$24-24 // func Yexp2(tls *TLS, x1 float64) (r1 float64) TEXT ·Yexp2(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x1+8(FP), AX @@ -3268,6 +3777,8 @@ TEXT ·Yexp2(SB),$24-24 // func Yexp2f(tls *TLS, x2 float32) (r1 float32) TEXT ·Yexp2f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x2+8(FP), AX @@ -3279,6 +3790,8 @@ TEXT ·Yexp2f(SB),$24-20 // func Yexp2l(tls *TLS, x float64) (r float64) TEXT ·Yexp2l(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3290,6 +3803,8 @@ TEXT ·Yexp2l(SB),$24-24 // func Yexpf(tls *TLS, x2 float32) (r1 float32) TEXT ·Yexpf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x2+8(FP), AX @@ -3301,6 +3816,8 @@ TEXT ·Yexpf(SB),$24-20 // func Yexpl(tls *TLS, x float64) (r float64) TEXT ·Yexpl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3312,6 +3829,8 @@ TEXT ·Yexpl(SB),$24-24 // func Yexplicit_bzero(tls *TLS, d uintptr, n Tsize_t) TEXT ·Yexplicit_bzero(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -3323,6 +3842,8 @@ TEXT ·Yexplicit_bzero(SB),$24-24 // func Yexpm1(tls *TLS, x3 float64) (r float64) TEXT ·Yexpm1(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -3334,6 +3855,8 @@ TEXT ·Yexpm1(SB),$24-24 // func Yexpm1f(tls *TLS, x3 float32) (r float32) TEXT ·Yexpm1f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -3345,6 +3868,8 @@ TEXT ·Yexpm1f(SB),$24-20 // func Yexpm1l(tls *TLS, x float64) (r float64) TEXT ·Yexpm1l(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3356,6 +3881,8 @@ TEXT ·Yexpm1l(SB),$24-24 // func Yfabs(tls *TLS, x float64) (r float64) TEXT ·Yfabs(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3367,6 +3894,8 @@ TEXT ·Yfabs(SB),$24-24 // func Yfabsf(tls *TLS, x float32) (r float32) TEXT ·Yfabsf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -3378,6 +3907,8 @@ TEXT ·Yfabsf(SB),$24-20 // func Yfabsl(tls *TLS, x float64) (r float64) TEXT ·Yfabsl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3389,6 +3920,8 @@ TEXT ·Yfabsl(SB),$24-24 // func Yfaccessat(tls *TLS, fd int32, filename uintptr, amode int32, flag int32) (r int32) TEXT ·Yfaccessat(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3406,6 +3939,8 @@ TEXT ·Yfaccessat(SB),$40-36 // func Yfallocate(tls *TLS, fd int32, mode int32, base Toff_t, len1 Toff_t) (r int32) TEXT ·Yfallocate(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3423,6 +3958,8 @@ TEXT ·Yfallocate(SB),$40-36 // func Yfanotify_init(tls *TLS, flags uint32, event_f_flags uint32) (r int32) TEXT ·Yfanotify_init(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL flags+8(FP), AX @@ -3436,6 +3973,8 @@ TEXT ·Yfanotify_init(SB),$24-20 // func Yfanotify_mark(tls *TLS, fanotify_fd int32, flags uint32, mask uint64, dfd int32, pathname uintptr) (r int32) TEXT ·Yfanotify_mark(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fanotify_fd+8(FP), AX @@ -3455,6 +3994,8 @@ TEXT ·Yfanotify_mark(SB),$48-44 // func Yfchdir(tls *TLS, fd int32) (r int32) TEXT ·Yfchdir(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3466,6 +4007,8 @@ TEXT ·Yfchdir(SB),$24-20 // func Yfchmod(tls *TLS, fd int32, mode Tmode_t) (r int32) TEXT ·Yfchmod(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3479,6 +4022,8 @@ TEXT ·Yfchmod(SB),$24-20 // func Yfchmodat(tls *TLS, fd int32, path uintptr, mode Tmode_t, flag int32) (r int32) TEXT ·Yfchmodat(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3496,6 +4041,8 @@ TEXT ·Yfchmodat(SB),$40-36 // func Yfchown(tls *TLS, fd int32, uid Tuid_t, gid Tgid_t) (r int32) TEXT ·Yfchown(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3511,6 +4058,8 @@ TEXT ·Yfchown(SB),$32-28 // func Yfchownat(tls *TLS, fd int32, path uintptr, uid Tuid_t, gid Tgid_t, flag int32) (r int32) TEXT ·Yfchownat(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3530,6 +4079,8 @@ TEXT ·Yfchownat(SB),$48-44 // func Yfclose(tls *TLS, f uintptr) (r1 int32) TEXT ·Yfclose(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3541,6 +4092,8 @@ TEXT ·Yfclose(SB),$24-20 // func Yfcntl(tls *TLS, fd int32, cmd int32, va uintptr) (r int32) TEXT ·Yfcntl(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3556,6 +4109,8 @@ TEXT ·Yfcntl(SB),$32-28 // func Yfcntl64(tls *TLS, fd int32, cmd int32, va uintptr) (r int32) TEXT ·Yfcntl64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3571,6 +4126,8 @@ TEXT ·Yfcntl64(SB),$32-28 // func Yfcvt(tls *TLS, x float64, n int32, dp uintptr, sign uintptr) (r uintptr) TEXT ·Yfcvt(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3588,6 +4145,8 @@ TEXT ·Yfcvt(SB),$48-48 // func Yfdatasync(tls *TLS, fd int32) (r int32) TEXT ·Yfdatasync(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3599,6 +4158,8 @@ TEXT ·Yfdatasync(SB),$24-20 // func Yfdim(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfdim(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3612,6 +4173,8 @@ TEXT ·Yfdim(SB),$32-32 // func Yfdimf(tls *TLS, x float32, y float32) (r float32) TEXT ·Yfdimf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -3625,6 +4188,8 @@ TEXT ·Yfdimf(SB),$24-20 // func Yfdiml(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfdiml(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -3638,6 +4203,8 @@ TEXT ·Yfdiml(SB),$32-32 // func Yfdopen(tls *TLS, fd int32, mode uintptr) (r uintptr) TEXT ·Yfdopen(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3651,6 +4218,8 @@ TEXT ·Yfdopen(SB),$32-32 // func Yfdopendir(tls *TLS, fd int32) (r uintptr) TEXT ·Yfdopendir(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3662,6 +4231,8 @@ TEXT ·Yfdopendir(SB),$24-24 // func Yfeclearexcept(tls *TLS, mask int32) (r int32) TEXT ·Yfeclearexcept(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL mask+8(FP), AX @@ -3673,6 +4244,8 @@ TEXT ·Yfeclearexcept(SB),$24-20 // func Yfegetenv(tls *TLS, envp uintptr) (r int32) TEXT ·Yfegetenv(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ envp+8(FP), AX @@ -3684,6 +4257,8 @@ TEXT ·Yfegetenv(SB),$24-20 // func Yfegetround(tls *TLS) (r int32) TEXT ·Yfegetround(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xfegetround(SB) @@ -3693,6 +4268,8 @@ TEXT ·Yfegetround(SB),$16-12 // func Yfeof(tls *TLS, f uintptr) (r int32) TEXT ·Yfeof(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3704,6 +4281,8 @@ TEXT ·Yfeof(SB),$24-20 // func Yfeof_unlocked(tls *TLS, f uintptr) (r int32) TEXT ·Yfeof_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3715,6 +4294,8 @@ TEXT ·Yfeof_unlocked(SB),$24-20 // func Yferaiseexcept(tls *TLS, mask int32) (r int32) TEXT ·Yferaiseexcept(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL mask+8(FP), AX @@ -3726,6 +4307,8 @@ TEXT ·Yferaiseexcept(SB),$24-20 // func Yferror(tls *TLS, f uintptr) (r int32) TEXT ·Yferror(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3737,6 +4320,8 @@ TEXT ·Yferror(SB),$24-20 // func Yferror_unlocked(tls *TLS, f uintptr) (r int32) TEXT ·Yferror_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3748,6 +4333,8 @@ TEXT ·Yferror_unlocked(SB),$24-20 // func Yfesetenv(tls *TLS, envp uintptr) (r int32) TEXT ·Yfesetenv(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ envp+8(FP), AX @@ -3759,6 +4346,8 @@ TEXT ·Yfesetenv(SB),$24-20 // func Yfetestexcept(tls *TLS, mask int32) (r int32) TEXT ·Yfetestexcept(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL mask+8(FP), AX @@ -3770,6 +4359,8 @@ TEXT ·Yfetestexcept(SB),$24-20 // func Yfexecve(tls *TLS, fd int32, argv uintptr, envp uintptr) (r1 int32) TEXT ·Yfexecve(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -3785,6 +4376,8 @@ TEXT ·Yfexecve(SB),$40-36 // func Yfflush(tls *TLS, f uintptr) (r1 int32) TEXT ·Yfflush(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3796,6 +4389,8 @@ TEXT ·Yfflush(SB),$24-20 // func Yfflush_unlocked(tls *TLS, f uintptr) (r int32) TEXT ·Yfflush_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3807,6 +4402,8 @@ TEXT ·Yfflush_unlocked(SB),$24-20 // func Yffs(tls *TLS, i int32) (r int32) TEXT ·Yffs(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL i+8(FP), AX @@ -3818,6 +4415,8 @@ TEXT ·Yffs(SB),$24-20 // func Yffsl(tls *TLS, i int64) (r int32) TEXT ·Yffsl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ i+8(FP), AX @@ -3829,6 +4428,8 @@ TEXT ·Yffsl(SB),$24-20 // func Yffsll(tls *TLS, i int64) (r int32) TEXT ·Yffsll(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ i+8(FP), AX @@ -3840,6 +4441,8 @@ TEXT ·Yffsll(SB),$24-20 // func Yfgetc(tls *TLS, f1 uintptr) (r int32) TEXT ·Yfgetc(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f1+8(FP), AX @@ -3851,6 +4454,8 @@ TEXT ·Yfgetc(SB),$24-20 // func Yfgetc_unlocked(tls *TLS, f uintptr) (r int32) TEXT ·Yfgetc_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3862,6 +4467,8 @@ TEXT ·Yfgetc_unlocked(SB),$24-20 // func Yfgetgrent(tls *TLS, f uintptr) (r uintptr) TEXT ·Yfgetgrent(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3873,6 +4480,8 @@ TEXT ·Yfgetgrent(SB),$24-24 // func Yfgetln(tls *TLS, f uintptr, plen uintptr) (r uintptr) TEXT ·Yfgetln(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3886,6 +4495,8 @@ TEXT ·Yfgetln(SB),$32-32 // func Yfgetpos(tls *TLS, f uintptr, pos uintptr) (r int32) TEXT ·Yfgetpos(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3899,6 +4510,8 @@ TEXT ·Yfgetpos(SB),$32-28 // func Yfgetpwent(tls *TLS, f uintptr) (r uintptr) TEXT ·Yfgetpwent(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3910,6 +4523,8 @@ TEXT ·Yfgetpwent(SB),$24-24 // func Yfgets(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) TEXT ·Yfgets(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -3925,6 +4540,8 @@ TEXT ·Yfgets(SB),$40-40 // func Yfgets_unlocked(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) TEXT ·Yfgets_unlocked(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -3940,6 +4557,8 @@ TEXT ·Yfgets_unlocked(SB),$40-40 // func Yfgetwc(tls *TLS, f uintptr) (r Twint_t) TEXT ·Yfgetwc(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3951,6 +4570,8 @@ TEXT ·Yfgetwc(SB),$24-20 // func Yfgetwc_unlocked(tls *TLS, f uintptr) (r Twint_t) TEXT ·Yfgetwc_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -3962,6 +4583,8 @@ TEXT ·Yfgetwc_unlocked(SB),$24-20 // func Yfgetws(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) TEXT ·Yfgetws(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -3977,6 +4600,8 @@ TEXT ·Yfgetws(SB),$40-40 // func Yfgetws_unlocked(tls *TLS, s uintptr, n int32, f uintptr) (r uintptr) TEXT ·Yfgetws_unlocked(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -3992,6 +4617,8 @@ TEXT ·Yfgetws_unlocked(SB),$40-40 // func Yfgetxattr(tls *TLS, filedes int32, name uintptr, value uintptr, size Tsize_t) (r Tssize_t) TEXT ·Yfgetxattr(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL filedes+8(FP), AX @@ -4009,6 +4636,8 @@ TEXT ·Yfgetxattr(SB),$48-48 // func Yfileno(tls *TLS, f uintptr) (r int32) TEXT ·Yfileno(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4020,6 +4649,8 @@ TEXT ·Yfileno(SB),$24-20 // func Yfileno_unlocked(tls *TLS, f uintptr) (r int32) TEXT ·Yfileno_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4031,6 +4662,8 @@ TEXT ·Yfileno_unlocked(SB),$24-20 // func Yfinite(tls *TLS, x float64) (r int32) TEXT ·Yfinite(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4042,6 +4675,8 @@ TEXT ·Yfinite(SB),$24-20 // func Yfinitef(tls *TLS, x float32) (r int32) TEXT ·Yfinitef(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -4053,6 +4688,8 @@ TEXT ·Yfinitef(SB),$24-20 // func Yflistxattr(tls *TLS, filedes int32, list uintptr, size Tsize_t) (r Tssize_t) TEXT ·Yflistxattr(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL filedes+8(FP), AX @@ -4068,6 +4705,8 @@ TEXT ·Yflistxattr(SB),$40-40 // func Yflock(tls *TLS, fd int32, op int32) (r int32) TEXT ·Yflock(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4081,6 +4720,8 @@ TEXT ·Yflock(SB),$24-20 // func Yflockfile(tls *TLS, f uintptr) TEXT ·Yflockfile(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4090,6 +4731,8 @@ TEXT ·Yflockfile(SB),$16-16 // func Yfloor(tls *TLS, x3 float64) (r float64) TEXT ·Yfloor(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -4101,6 +4744,8 @@ TEXT ·Yfloor(SB),$24-24 // func Yfloorf(tls *TLS, x3 float32) (r float32) TEXT ·Yfloorf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -4112,6 +4757,8 @@ TEXT ·Yfloorf(SB),$24-20 // func Yfloorl(tls *TLS, x float64) (r float64) TEXT ·Yfloorl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4123,6 +4770,8 @@ TEXT ·Yfloorl(SB),$24-24 // func Yfma(tls *TLS, x1 float64, y float64, z float64) (r1 float64) TEXT ·Yfma(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x1+8(FP), AX @@ -4138,6 +4787,8 @@ TEXT ·Yfma(SB),$40-40 // func Yfmal(tls *TLS, x float64, y float64, z float64) (r float64) TEXT ·Yfmal(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4153,6 +4804,8 @@ TEXT ·Yfmal(SB),$40-40 // func Yfmax(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfmax(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4166,6 +4819,8 @@ TEXT ·Yfmax(SB),$32-32 // func Yfmaxf(tls *TLS, x float32, y float32) (r float32) TEXT ·Yfmaxf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -4179,6 +4834,8 @@ TEXT ·Yfmaxf(SB),$24-20 // func Yfmaxl(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfmaxl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4192,6 +4849,8 @@ TEXT ·Yfmaxl(SB),$32-32 // func Yfmemopen(tls *TLS, buf uintptr, size Tsize_t, mode uintptr) (r uintptr) TEXT ·Yfmemopen(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ buf+8(FP), AX @@ -4207,6 +4866,8 @@ TEXT ·Yfmemopen(SB),$40-40 // func Yfmin(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfmin(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4220,6 +4881,8 @@ TEXT ·Yfmin(SB),$32-32 // func Yfminf(tls *TLS, x float32, y float32) (r float32) TEXT ·Yfminf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -4233,6 +4896,8 @@ TEXT ·Yfminf(SB),$24-20 // func Yfminl(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfminl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4246,6 +4911,8 @@ TEXT ·Yfminl(SB),$32-32 // func Yfmod(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfmod(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4259,6 +4926,8 @@ TEXT ·Yfmod(SB),$32-32 // func Yfmodf(tls *TLS, x float32, y float32) (r float32) TEXT ·Yfmodf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -4272,6 +4941,8 @@ TEXT ·Yfmodf(SB),$24-20 // func Yfmodl(tls *TLS, x float64, y float64) (r float64) TEXT ·Yfmodl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4285,6 +4956,8 @@ TEXT ·Yfmodl(SB),$32-32 // func Yfmtmsg(tls *TLS, classification int64, label uintptr, severity int32, text uintptr, action uintptr, tag uintptr) (r int32) TEXT ·Yfmtmsg(SB),$64-60 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ classification+8(FP), AX @@ -4306,6 +4979,8 @@ TEXT ·Yfmtmsg(SB),$64-60 // func Yfnmatch(tls *TLS, pat uintptr, str uintptr, flags int32) (r int32) TEXT ·Yfnmatch(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ pat+8(FP), AX @@ -4321,6 +4996,8 @@ TEXT ·Yfnmatch(SB),$40-36 // func Yfopen(tls *TLS, filename uintptr, mode uintptr) (r uintptr) TEXT ·Yfopen(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -4334,6 +5011,8 @@ TEXT ·Yfopen(SB),$32-32 // func Yfopen64(tls *TLS, filename uintptr, mode uintptr) (r uintptr) TEXT ·Yfopen64(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -4347,6 +5026,8 @@ TEXT ·Yfopen64(SB),$32-32 // func Yfopencookie(tls *TLS, cookie uintptr, mode uintptr, iofuncs Tcookie_io_functions_t) (r uintptr) TEXT ·Yfopencookie(SB),$64-64 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ cookie+8(FP), AX @@ -4368,6 +5049,8 @@ TEXT ·Yfopencookie(SB),$64-64 // func Yfork(t *TLS) int32 TEXT ·Yfork(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) CALL ·Xfork(SB) @@ -4377,6 +5060,8 @@ TEXT ·Yfork(SB),$16-12 // func Yfpathconf(tls *TLS, fd int32, name int32) (r int64) TEXT ·Yfpathconf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4390,6 +5075,8 @@ TEXT ·Yfpathconf(SB),$24-24 // func Yfprintf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Yfprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4405,6 +5092,8 @@ TEXT ·Yfprintf(SB),$40-36 // func Yfpurge(tls *TLS, f uintptr) (r int32) TEXT ·Yfpurge(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4416,6 +5105,8 @@ TEXT ·Yfpurge(SB),$24-20 // func Yfputc(tls *TLS, c1 int32, f1 uintptr) (r int32) TEXT ·Yfputc(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c1+8(FP), AX @@ -4429,6 +5120,8 @@ TEXT ·Yfputc(SB),$32-28 // func Yfputc_unlocked(tls *TLS, c int32, f uintptr) (r int32) TEXT ·Yfputc_unlocked(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -4442,6 +5135,8 @@ TEXT ·Yfputc_unlocked(SB),$32-28 // func Yfputs(tls *TLS, s uintptr, f uintptr) (r int32) TEXT ·Yfputs(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -4455,6 +5150,8 @@ TEXT ·Yfputs(SB),$32-28 // func Yfputs_unlocked(tls *TLS, s uintptr, f uintptr) (r int32) TEXT ·Yfputs_unlocked(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -4468,6 +5165,8 @@ TEXT ·Yfputs_unlocked(SB),$32-28 // func Yfputwc(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) TEXT ·Yfputwc(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -4481,6 +5180,8 @@ TEXT ·Yfputwc(SB),$32-28 // func Yfputwc_unlocked(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) TEXT ·Yfputwc_unlocked(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -4494,6 +5195,8 @@ TEXT ·Yfputwc_unlocked(SB),$32-28 // func Yfputws(tls *TLS, _ws uintptr, f uintptr) (r int32) TEXT ·Yfputws(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ _ws+8(FP), AX @@ -4507,6 +5210,8 @@ TEXT ·Yfputws(SB),$32-28 // func Yfputws_unlocked(tls *TLS, _ws uintptr, f uintptr) (r int32) TEXT ·Yfputws_unlocked(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ _ws+8(FP), AX @@ -4520,6 +5225,8 @@ TEXT ·Yfputws_unlocked(SB),$32-28 // func Yfread(tls *TLS, destv uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) TEXT ·Yfread(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ destv+8(FP), AX @@ -4537,6 +5244,8 @@ TEXT ·Yfread(SB),$48-48 // func Yfread_unlocked(tls *TLS, destv uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) TEXT ·Yfread_unlocked(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ destv+8(FP), AX @@ -4554,6 +5263,8 @@ TEXT ·Yfread_unlocked(SB),$48-48 // func Yfree(tls *TLS, p uintptr) TEXT ·Yfree(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p+8(FP), AX @@ -4563,6 +5274,8 @@ TEXT ·Yfree(SB),$16-16 // func Yfreeaddrinfo(tls *TLS, p uintptr) TEXT ·Yfreeaddrinfo(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p+8(FP), AX @@ -4572,6 +5285,8 @@ TEXT ·Yfreeaddrinfo(SB),$16-16 // func Yfreeifaddrs(tls *TLS, ifp uintptr) TEXT ·Yfreeifaddrs(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ifp+8(FP), AX @@ -4581,6 +5296,8 @@ TEXT ·Yfreeifaddrs(SB),$16-16 // func Yfreelocale(tls *TLS, l Tlocale_t) TEXT ·Yfreelocale(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -4590,6 +5307,8 @@ TEXT ·Yfreelocale(SB),$16-16 // func Yfremovexattr(tls *TLS, fd int32, name uintptr) (r int32) TEXT ·Yfremovexattr(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4603,6 +5322,8 @@ TEXT ·Yfremovexattr(SB),$32-28 // func Yfreopen(tls *TLS, filename uintptr, mode uintptr, f uintptr) (r uintptr) TEXT ·Yfreopen(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -4618,6 +5339,8 @@ TEXT ·Yfreopen(SB),$40-40 // func Yfrexp(tls *TLS, x float64, e uintptr) (r float64) TEXT ·Yfrexp(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4631,6 +5354,8 @@ TEXT ·Yfrexp(SB),$32-32 // func Yfrexpf(tls *TLS, x float32, e uintptr) (r float32) TEXT ·Yfrexpf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -4644,6 +5369,8 @@ TEXT ·Yfrexpf(SB),$32-28 // func Yfrexpl(tls *TLS, x float64, e uintptr) (r float64) TEXT ·Yfrexpl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -4657,6 +5384,8 @@ TEXT ·Yfrexpl(SB),$32-32 // func Yfscanf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Yfscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4672,6 +5401,8 @@ TEXT ·Yfscanf(SB),$40-36 // func Yfseek(tls *TLS, f uintptr, off int64, whence int32) (r int32) TEXT ·Yfseek(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4687,6 +5418,8 @@ TEXT ·Yfseek(SB),$40-36 // func Yfseeko(tls *TLS, f uintptr, off Toff_t, whence int32) (r int32) TEXT ·Yfseeko(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4702,6 +5435,8 @@ TEXT ·Yfseeko(SB),$40-36 // func Yfsetpos(tls *TLS, f uintptr, pos uintptr) (r int32) TEXT ·Yfsetpos(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4715,6 +5450,8 @@ TEXT ·Yfsetpos(SB),$32-28 // func Yfsetxattr(tls *TLS, filedes int32, name uintptr, value uintptr, size Tsize_t, flags int32) (r int32) TEXT ·Yfsetxattr(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL filedes+8(FP), AX @@ -4734,6 +5471,8 @@ TEXT ·Yfsetxattr(SB),$56-52 // func Yfstat(tls *TLS, fd int32, st uintptr) (r int32) TEXT ·Yfstat(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4747,6 +5486,8 @@ TEXT ·Yfstat(SB),$32-28 // func Yfstat64(tls *TLS, fd int32, st uintptr) (r int32) TEXT ·Yfstat64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4760,6 +5501,8 @@ TEXT ·Yfstat64(SB),$32-28 // func Yfstatat(tls *TLS, fd int32, path uintptr, st uintptr, flag int32) (r int32) TEXT ·Yfstatat(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4777,6 +5520,8 @@ TEXT ·Yfstatat(SB),$48-44 // func Yfstatfs(tls *TLS, fd int32, buf uintptr) (r int32) TEXT ·Yfstatfs(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4790,6 +5535,8 @@ TEXT ·Yfstatfs(SB),$32-28 // func Yfstatvfs(tls *TLS, fd int32, buf uintptr) (r int32) TEXT ·Yfstatvfs(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4803,6 +5550,8 @@ TEXT ·Yfstatvfs(SB),$32-28 // func Yfsync(tls *TLS, fd int32) (r int32) TEXT ·Yfsync(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4814,6 +5563,8 @@ TEXT ·Yfsync(SB),$24-20 // func Yftell(tls *TLS, f uintptr) (r int64) TEXT ·Yftell(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4825,6 +5576,8 @@ TEXT ·Yftell(SB),$24-24 // func Yftello(tls *TLS, f uintptr) (r Toff_t) TEXT ·Yftello(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4836,6 +5589,8 @@ TEXT ·Yftello(SB),$24-24 // func Yftime(tls *TLS, tp uintptr) (r int32) TEXT ·Yftime(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tp+8(FP), AX @@ -4847,6 +5602,8 @@ TEXT ·Yftime(SB),$24-20 // func Yftok(tls *TLS, path uintptr, id int32) (r Tkey_t) TEXT ·Yftok(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -4860,6 +5617,8 @@ TEXT ·Yftok(SB),$32-28 // func Yftruncate(tls *TLS, fd int32, length Toff_t) (r int32) TEXT ·Yftruncate(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4873,6 +5632,8 @@ TEXT ·Yftruncate(SB),$32-28 // func Yftruncate64(tls *TLS, fd int32, length Toff_t) (r int32) TEXT ·Yftruncate64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -4886,6 +5647,8 @@ TEXT ·Yftruncate64(SB),$32-28 // func Yftrylockfile(tls *TLS, f uintptr) (r int32) TEXT ·Yftrylockfile(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4897,6 +5660,8 @@ TEXT ·Yftrylockfile(SB),$24-20 // func Yfts64_close(t *TLS, ftsp uintptr) int32 TEXT ·Yfts64_close(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ ftsp+8(FP), AX @@ -4908,6 +5673,8 @@ TEXT ·Yfts64_close(SB),$24-20 // func Yfts64_open(t *TLS, path_argv uintptr, options int32, compar uintptr) uintptr TEXT ·Yfts64_open(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ path_argv+8(FP), AX @@ -4923,6 +5690,8 @@ TEXT ·Yfts64_open(SB),$40-40 // func Yfts64_read(t *TLS, ftsp uintptr) uintptr TEXT ·Yfts64_read(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ ftsp+8(FP), AX @@ -4934,6 +5703,8 @@ TEXT ·Yfts64_read(SB),$24-24 // func Yfts_close(t *TLS, ftsp uintptr) int32 TEXT ·Yfts_close(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ ftsp+8(FP), AX @@ -4945,6 +5716,8 @@ TEXT ·Yfts_close(SB),$24-20 // func Yfts_open(t *TLS, path_argv uintptr, options int32, compar uintptr) uintptr TEXT ·Yfts_open(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ path_argv+8(FP), AX @@ -4960,6 +5733,8 @@ TEXT ·Yfts_open(SB),$40-40 // func Yfts_read(t *TLS, ftsp uintptr) uintptr TEXT ·Yfts_read(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ ftsp+8(FP), AX @@ -4971,6 +5746,8 @@ TEXT ·Yfts_read(SB),$24-24 // func Yftw(tls *TLS, path uintptr, fn uintptr, fd_limit int32) (r int32) TEXT ·Yftw(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -4986,6 +5763,8 @@ TEXT ·Yftw(SB),$40-36 // func Yfunlockfile(tls *TLS, f uintptr) TEXT ·Yfunlockfile(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -4995,6 +5774,8 @@ TEXT ·Yfunlockfile(SB),$16-16 // func Yfutimens(tls *TLS, fd int32, times uintptr) (r int32) TEXT ·Yfutimens(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -5008,6 +5789,8 @@ TEXT ·Yfutimens(SB),$32-28 // func Yfutimes(tls *TLS, fd int32, tv uintptr) (r int32) TEXT ·Yfutimes(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -5021,6 +5804,8 @@ TEXT ·Yfutimes(SB),$32-28 // func Yfutimesat(tls *TLS, dirfd int32, pathname uintptr, times uintptr) (r int32) TEXT ·Yfutimesat(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL dirfd+8(FP), AX @@ -5036,6 +5821,8 @@ TEXT ·Yfutimesat(SB),$40-36 // func Yfwide(tls *TLS, f uintptr, mode int32) (r int32) TEXT ·Yfwide(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -5049,6 +5836,8 @@ TEXT ·Yfwide(SB),$32-28 // func Yfwprintf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Yfwprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -5064,6 +5853,8 @@ TEXT ·Yfwprintf(SB),$40-36 // func Yfwrite(tls *TLS, src uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) TEXT ·Yfwrite(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ src+8(FP), AX @@ -5081,6 +5872,8 @@ TEXT ·Yfwrite(SB),$48-48 // func Yfwrite_unlocked(tls *TLS, src uintptr, size Tsize_t, nmemb Tsize_t, f uintptr) (r Tsize_t) TEXT ·Yfwrite_unlocked(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ src+8(FP), AX @@ -5098,6 +5891,8 @@ TEXT ·Yfwrite_unlocked(SB),$48-48 // func Yfwscanf(tls *TLS, f uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Yfwscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -5113,6 +5908,8 @@ TEXT ·Yfwscanf(SB),$40-36 // func Ygai_strerror(tls *TLS, ecode int32) (r uintptr) TEXT ·Ygai_strerror(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL ecode+8(FP), AX @@ -5124,6 +5921,8 @@ TEXT ·Ygai_strerror(SB),$24-24 // func Ygcvt(tls *TLS, x float64, n int32, b uintptr) (r uintptr) TEXT ·Ygcvt(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -5139,6 +5938,8 @@ TEXT ·Ygcvt(SB),$40-40 // func Yget_avphys_pages(tls *TLS) (r int64) TEXT ·Yget_avphys_pages(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xget_avphys_pages(SB) @@ -5148,6 +5949,8 @@ TEXT ·Yget_avphys_pages(SB),$16-16 // func Yget_current_dir_name(tls *TLS) (r uintptr) TEXT ·Yget_current_dir_name(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xget_current_dir_name(SB) @@ -5157,6 +5960,8 @@ TEXT ·Yget_current_dir_name(SB),$16-16 // func Yget_nprocs(tls *TLS) (r int32) TEXT ·Yget_nprocs(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xget_nprocs(SB) @@ -5166,6 +5971,8 @@ TEXT ·Yget_nprocs(SB),$16-12 // func Yget_nprocs_conf(tls *TLS) (r int32) TEXT ·Yget_nprocs_conf(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xget_nprocs_conf(SB) @@ -5175,6 +5982,8 @@ TEXT ·Yget_nprocs_conf(SB),$16-12 // func Yget_phys_pages(tls *TLS) (r int64) TEXT ·Yget_phys_pages(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xget_phys_pages(SB) @@ -5184,6 +5993,8 @@ TEXT ·Yget_phys_pages(SB),$16-16 // func Ygetaddrinfo(tls *TLS, host uintptr, serv uintptr, hint uintptr, res uintptr) (r1 int32) TEXT ·Ygetaddrinfo(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ host+8(FP), AX @@ -5201,6 +6012,8 @@ TEXT ·Ygetaddrinfo(SB),$48-44 // func Ygetauxval(tls *TLS, item uint64) (r uint64) TEXT ·Ygetauxval(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ item+8(FP), AX @@ -5212,6 +6025,8 @@ TEXT ·Ygetauxval(SB),$24-24 // func Ygetc(tls *TLS, f1 uintptr) (r int32) TEXT ·Ygetc(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f1+8(FP), AX @@ -5223,6 +6038,8 @@ TEXT ·Ygetc(SB),$24-20 // func Ygetc_unlocked(tls *TLS, f uintptr) (r int32) TEXT ·Ygetc_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -5234,6 +6051,8 @@ TEXT ·Ygetc_unlocked(SB),$24-20 // func Ygetchar(tls *TLS) (r int32) TEXT ·Ygetchar(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetchar(SB) @@ -5243,6 +6062,8 @@ TEXT ·Ygetchar(SB),$16-12 // func Ygetchar_unlocked(tls *TLS) (r int32) TEXT ·Ygetchar_unlocked(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetchar_unlocked(SB) @@ -5252,6 +6073,8 @@ TEXT ·Ygetchar_unlocked(SB),$16-12 // func Ygetcwd(tls *TLS, buf uintptr, size Tsize_t) (r uintptr) TEXT ·Ygetcwd(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ buf+8(FP), AX @@ -5265,6 +6088,8 @@ TEXT ·Ygetcwd(SB),$32-32 // func Ygetdate(tls *TLS, s uintptr) (r uintptr) TEXT ·Ygetdate(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -5276,6 +6101,8 @@ TEXT ·Ygetdate(SB),$24-24 // func Ygetdelim(tls *TLS, s uintptr, n uintptr, delim int32, f uintptr) (r Tssize_t) TEXT ·Ygetdelim(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -5293,6 +6120,8 @@ TEXT ·Ygetdelim(SB),$48-48 // func Ygetdents(tls *TLS, fd int32, buf uintptr, len1 Tsize_t) (r int32) TEXT ·Ygetdents(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -5308,6 +6137,8 @@ TEXT ·Ygetdents(SB),$40-36 // func Ygetdomainname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) TEXT ·Ygetdomainname(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5321,6 +6152,8 @@ TEXT ·Ygetdomainname(SB),$32-28 // func Ygetdtablesize(tls *TLS) (r int32) TEXT ·Ygetdtablesize(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetdtablesize(SB) @@ -5330,6 +6163,8 @@ TEXT ·Ygetdtablesize(SB),$16-12 // func Ygetegid(tls *TLS) (r Tgid_t) TEXT ·Ygetegid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetegid(SB) @@ -5339,6 +6174,8 @@ TEXT ·Ygetegid(SB),$16-12 // func Ygetentropy(tls *TLS, buffer uintptr, len1 Tsize_t) (r int32) TEXT ·Ygetentropy(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ buffer+8(FP), AX @@ -5352,6 +6189,8 @@ TEXT ·Ygetentropy(SB),$32-28 // func Ygetenv(tls *TLS, name uintptr) (r uintptr) TEXT ·Ygetenv(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5363,6 +6202,8 @@ TEXT ·Ygetenv(SB),$24-24 // func Ygeteuid(tls *TLS) (r Tuid_t) TEXT ·Ygeteuid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgeteuid(SB) @@ -5372,6 +6213,8 @@ TEXT ·Ygeteuid(SB),$16-12 // func Ygetgid(tls *TLS) (r Tgid_t) TEXT ·Ygetgid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetgid(SB) @@ -5381,6 +6224,8 @@ TEXT ·Ygetgid(SB),$16-12 // func Ygetgrent(tls *TLS) (r uintptr) TEXT ·Ygetgrent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetgrent(SB) @@ -5390,6 +6235,8 @@ TEXT ·Ygetgrent(SB),$16-16 // func Ygetgrgid(tls *TLS, gid Tgid_t) (r uintptr) TEXT ·Ygetgrgid(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL gid+8(FP), AX @@ -5401,6 +6248,8 @@ TEXT ·Ygetgrgid(SB),$24-24 // func Ygetgrgid_r(tls *TLS, gid Tgid_t, gr uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) TEXT ·Ygetgrgid_r(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL gid+8(FP), AX @@ -5420,6 +6269,8 @@ TEXT ·Ygetgrgid_r(SB),$56-52 // func Ygetgrnam(tls *TLS, name uintptr) (r uintptr) TEXT ·Ygetgrnam(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5431,6 +6282,8 @@ TEXT ·Ygetgrnam(SB),$24-24 // func Ygetgrnam_r(tls *TLS, name uintptr, gr uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) TEXT ·Ygetgrnam_r(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5450,6 +6303,8 @@ TEXT ·Ygetgrnam_r(SB),$56-52 // func Ygetgrouplist(tls *TLS, user uintptr, gid Tgid_t, groups uintptr, ngroups uintptr) (r int32) TEXT ·Ygetgrouplist(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ user+8(FP), AX @@ -5467,6 +6322,8 @@ TEXT ·Ygetgrouplist(SB),$48-44 // func Ygetgroups(tls *TLS, count int32, list uintptr) (r int32) TEXT ·Ygetgroups(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL count+8(FP), AX @@ -5480,6 +6337,8 @@ TEXT ·Ygetgroups(SB),$32-28 // func Ygethostbyaddr(tls *TLS, a uintptr, l Tsocklen_t, af int32) (r uintptr) TEXT ·Ygethostbyaddr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -5495,6 +6354,8 @@ TEXT ·Ygethostbyaddr(SB),$32-32 // func Ygethostbyaddr_r(tls *TLS, a uintptr, l Tsocklen_t, af int32, h uintptr, buf uintptr, buflen Tsize_t, res uintptr, err uintptr) (r int32) TEXT ·Ygethostbyaddr_r(SB),$72-68 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -5520,6 +6381,8 @@ TEXT ·Ygethostbyaddr_r(SB),$72-68 // func Ygethostbyname(tls *TLS, name uintptr) (r uintptr) TEXT ·Ygethostbyname(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5531,6 +6394,8 @@ TEXT ·Ygethostbyname(SB),$24-24 // func Ygethostbyname2(tls *TLS, name uintptr, af int32) (r uintptr) TEXT ·Ygethostbyname2(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5544,6 +6409,8 @@ TEXT ·Ygethostbyname2(SB),$32-32 // func Ygethostbyname2_r(tls *TLS, name uintptr, af int32, h uintptr, buf uintptr, buflen Tsize_t, res uintptr, err uintptr) (r int32) TEXT ·Ygethostbyname2_r(SB),$72-68 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5567,6 +6434,8 @@ TEXT ·Ygethostbyname2_r(SB),$72-68 // func Ygethostbyname_r(tls *TLS, name uintptr, h uintptr, buf uintptr, buflen Tsize_t, res uintptr, err uintptr) (r int32) TEXT ·Ygethostbyname_r(SB),$64-60 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5588,6 +6457,8 @@ TEXT ·Ygethostbyname_r(SB),$64-60 // func Ygethostent(tls *TLS) (r uintptr) TEXT ·Ygethostent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgethostent(SB) @@ -5597,6 +6468,8 @@ TEXT ·Ygethostent(SB),$16-16 // func Ygethostid(tls *TLS) (r int64) TEXT ·Ygethostid(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgethostid(SB) @@ -5606,6 +6479,8 @@ TEXT ·Ygethostid(SB),$16-16 // func Ygethostname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) TEXT ·Ygethostname(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5619,6 +6494,8 @@ TEXT ·Ygethostname(SB),$32-28 // func Ygetifaddrs(tls *TLS, ifap uintptr) (r1 int32) TEXT ·Ygetifaddrs(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ifap+8(FP), AX @@ -5630,6 +6507,8 @@ TEXT ·Ygetifaddrs(SB),$24-20 // func Ygetitimer(tls *TLS, which int32, old uintptr) (r1 int32) TEXT ·Ygetitimer(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL which+8(FP), AX @@ -5643,6 +6522,8 @@ TEXT ·Ygetitimer(SB),$32-28 // func Ygetline(tls *TLS, s uintptr, n uintptr, f uintptr) (r Tssize_t) TEXT ·Ygetline(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -5658,6 +6539,8 @@ TEXT ·Ygetline(SB),$40-40 // func Ygetloadavg(tls *TLS, a uintptr, n int32) (r int32) TEXT ·Ygetloadavg(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -5671,6 +6554,8 @@ TEXT ·Ygetloadavg(SB),$32-28 // func Ygetlogin(tls *TLS) (r uintptr) TEXT ·Ygetlogin(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetlogin(SB) @@ -5680,6 +6565,8 @@ TEXT ·Ygetlogin(SB),$16-16 // func Ygetlogin_r(tls *TLS, name uintptr, size Tsize_t) (r int32) TEXT ·Ygetlogin_r(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5693,6 +6580,8 @@ TEXT ·Ygetlogin_r(SB),$32-28 // func Ygetmntent(tls *TLS, f uintptr) (r uintptr) TEXT ·Ygetmntent(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -5704,6 +6593,8 @@ TEXT ·Ygetmntent(SB),$24-24 // func Ygetmntent_r(tls *TLS, f uintptr, mnt uintptr, linebuf uintptr, buflen int32) (r uintptr) TEXT ·Ygetmntent_r(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -5721,6 +6612,8 @@ TEXT ·Ygetmntent_r(SB),$48-48 // func Ygetnameinfo(tls *TLS, sa uintptr, sl Tsocklen_t, node uintptr, nodelen Tsocklen_t, serv uintptr, servlen Tsocklen_t, flags int32) (r int32) TEXT ·Ygetnameinfo(SB),$64-60 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ sa+8(FP), AX @@ -5744,6 +6637,8 @@ TEXT ·Ygetnameinfo(SB),$64-60 // func Ygetnetbyaddr(tls *TLS, net Tuint32_t, type1 int32) (r uintptr) TEXT ·Ygetnetbyaddr(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL net+8(FP), AX @@ -5757,6 +6652,8 @@ TEXT ·Ygetnetbyaddr(SB),$24-24 // func Ygetnetbyname(tls *TLS, name uintptr) (r uintptr) TEXT ·Ygetnetbyname(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5768,6 +6665,8 @@ TEXT ·Ygetnetbyname(SB),$24-24 // func Ygetnetent(tls *TLS) (r uintptr) TEXT ·Ygetnetent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetnetent(SB) @@ -5777,6 +6676,8 @@ TEXT ·Ygetnetent(SB),$16-16 // func Ygetopt(tls *TLS, argc int32, argv uintptr, optstring uintptr) (r int32) TEXT ·Ygetopt(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL argc+8(FP), AX @@ -5792,6 +6693,8 @@ TEXT ·Ygetopt(SB),$40-36 // func Ygetopt_long(tls *TLS, argc int32, argv uintptr, optstring uintptr, longopts uintptr, idx uintptr) (r int32) TEXT ·Ygetopt_long(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL argc+8(FP), AX @@ -5811,6 +6714,8 @@ TEXT ·Ygetopt_long(SB),$56-52 // func Ygetopt_long_only(tls *TLS, argc int32, argv uintptr, optstring uintptr, longopts uintptr, idx uintptr) (r int32) TEXT ·Ygetopt_long_only(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL argc+8(FP), AX @@ -5830,6 +6735,8 @@ TEXT ·Ygetopt_long_only(SB),$56-52 // func Ygetpagesize(tls *TLS) (r int32) TEXT ·Ygetpagesize(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetpagesize(SB) @@ -5839,6 +6746,8 @@ TEXT ·Ygetpagesize(SB),$16-12 // func Ygetpass(tls *TLS, prompt uintptr) (r uintptr) TEXT ·Ygetpass(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ prompt+8(FP), AX @@ -5850,6 +6759,8 @@ TEXT ·Ygetpass(SB),$24-24 // func Ygetpeername(tls *TLS, fd int32, addr uintptr, len1 uintptr) (r1 int32) TEXT ·Ygetpeername(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -5865,6 +6776,8 @@ TEXT ·Ygetpeername(SB),$40-36 // func Ygetpgid(tls *TLS, pid Tpid_t) (r Tpid_t) TEXT ·Ygetpgid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -5876,6 +6789,8 @@ TEXT ·Ygetpgid(SB),$24-20 // func Ygetpgrp(tls *TLS) (r Tpid_t) TEXT ·Ygetpgrp(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetpgrp(SB) @@ -5885,6 +6800,8 @@ TEXT ·Ygetpgrp(SB),$16-12 // func Ygetpid(tls *TLS) (r Tpid_t) TEXT ·Ygetpid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetpid(SB) @@ -5894,6 +6811,8 @@ TEXT ·Ygetpid(SB),$16-12 // func Ygetppid(tls *TLS) (r Tpid_t) TEXT ·Ygetppid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetppid(SB) @@ -5903,6 +6822,8 @@ TEXT ·Ygetppid(SB),$16-12 // func Ygetpriority(tls *TLS, which int32, who Tid_t) (r int32) TEXT ·Ygetpriority(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL which+8(FP), AX @@ -5916,6 +6837,8 @@ TEXT ·Ygetpriority(SB),$24-20 // func Ygetprotobyname(tls *TLS, name uintptr) (r uintptr) TEXT ·Ygetprotobyname(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5927,6 +6850,8 @@ TEXT ·Ygetprotobyname(SB),$24-24 // func Ygetprotobynumber(tls *TLS, num int32) (r uintptr) TEXT ·Ygetprotobynumber(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL num+8(FP), AX @@ -5938,6 +6863,8 @@ TEXT ·Ygetprotobynumber(SB),$24-24 // func Ygetprotoent(tls *TLS) (r uintptr) TEXT ·Ygetprotoent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetprotoent(SB) @@ -5947,6 +6874,8 @@ TEXT ·Ygetprotoent(SB),$16-16 // func Ygetpwent(tls *TLS) (r uintptr) TEXT ·Ygetpwent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetpwent(SB) @@ -5956,6 +6885,8 @@ TEXT ·Ygetpwent(SB),$16-16 // func Ygetpwnam(tls *TLS, name uintptr) (r uintptr) TEXT ·Ygetpwnam(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5967,6 +6898,8 @@ TEXT ·Ygetpwnam(SB),$24-24 // func Ygetpwnam_r(tls *TLS, name uintptr, pw uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) TEXT ·Ygetpwnam_r(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -5986,6 +6919,8 @@ TEXT ·Ygetpwnam_r(SB),$56-52 // func Ygetpwuid(tls *TLS, uid Tuid_t) (r uintptr) TEXT ·Ygetpwuid(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL uid+8(FP), AX @@ -5997,6 +6932,8 @@ TEXT ·Ygetpwuid(SB),$24-24 // func Ygetpwuid_r(tls *TLS, uid Tuid_t, pw uintptr, buf uintptr, size Tsize_t, res uintptr) (r int32) TEXT ·Ygetpwuid_r(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL uid+8(FP), AX @@ -6016,6 +6953,8 @@ TEXT ·Ygetpwuid_r(SB),$56-52 // func Ygetrandom(tls *TLS, buf uintptr, buflen Tsize_t, flags uint32) (r Tssize_t) TEXT ·Ygetrandom(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ buf+8(FP), AX @@ -6031,6 +6970,8 @@ TEXT ·Ygetrandom(SB),$40-40 // func Ygetresgid(tls *TLS, rgid uintptr, egid uintptr, sgid uintptr) (r int32) TEXT ·Ygetresgid(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ rgid+8(FP), AX @@ -6046,6 +6987,8 @@ TEXT ·Ygetresgid(SB),$40-36 // func Ygetresuid(tls *TLS, ruid uintptr, euid uintptr, suid uintptr) (r int32) TEXT ·Ygetresuid(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ruid+8(FP), AX @@ -6061,6 +7004,8 @@ TEXT ·Ygetresuid(SB),$40-36 // func Ygetrlimit(tls *TLS, resource int32, rlim uintptr) (r int32) TEXT ·Ygetrlimit(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL resource+8(FP), AX @@ -6074,6 +7019,8 @@ TEXT ·Ygetrlimit(SB),$32-28 // func Ygetrlimit64(tls *TLS, resource int32, rlim uintptr) (r int32) TEXT ·Ygetrlimit64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL resource+8(FP), AX @@ -6087,6 +7034,8 @@ TEXT ·Ygetrlimit64(SB),$32-28 // func Ygetrusage(tls *TLS, who int32, ru uintptr) (r1 int32) TEXT ·Ygetrusage(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL who+8(FP), AX @@ -6100,6 +7049,8 @@ TEXT ·Ygetrusage(SB),$32-28 // func Ygets(tls *TLS, s uintptr) (r uintptr) TEXT ·Ygets(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -6111,6 +7062,8 @@ TEXT ·Ygets(SB),$24-24 // func Ygetservbyname(tls *TLS, name uintptr, prots uintptr) (r uintptr) TEXT ·Ygetservbyname(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -6124,6 +7077,8 @@ TEXT ·Ygetservbyname(SB),$32-32 // func Ygetservbyname_r(tls *TLS, name uintptr, prots uintptr, se uintptr, buf uintptr, buflen Tsize_t, res uintptr) (r int32) TEXT ·Ygetservbyname_r(SB),$64-60 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -6145,6 +7100,8 @@ TEXT ·Ygetservbyname_r(SB),$64-60 // func Ygetservent(tls *TLS) (r uintptr) TEXT ·Ygetservent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetservent(SB) @@ -6154,6 +7111,8 @@ TEXT ·Ygetservent(SB),$16-16 // func Ygetsid(tls *TLS, pid Tpid_t) (r Tpid_t) TEXT ·Ygetsid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -6165,6 +7124,8 @@ TEXT ·Ygetsid(SB),$24-20 // func Ygetsockname(tls *TLS, fd int32, addr uintptr, len1 uintptr) (r1 int32) TEXT ·Ygetsockname(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -6180,6 +7141,8 @@ TEXT ·Ygetsockname(SB),$40-36 // func Ygetsockopt(tls *TLS, fd int32, level int32, optname int32, optval uintptr, optlen uintptr) (r2 int32) TEXT ·Ygetsockopt(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -6199,6 +7162,8 @@ TEXT ·Ygetsockopt(SB),$48-44 // func Ygetspent(tls *TLS) (r uintptr) TEXT ·Ygetspent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetspent(SB) @@ -6208,6 +7173,8 @@ TEXT ·Ygetspent(SB),$16-16 // func Ygetsubopt(tls *TLS, opt uintptr, keys uintptr, val uintptr) (r int32) TEXT ·Ygetsubopt(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ opt+8(FP), AX @@ -6223,6 +7190,8 @@ TEXT ·Ygetsubopt(SB),$40-36 // func Ygettext(tls *TLS, msgid uintptr) (r uintptr) TEXT ·Ygettext(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ msgid+8(FP), AX @@ -6234,6 +7203,8 @@ TEXT ·Ygettext(SB),$24-24 // func Ygettimeofday(tls *TLS, tv uintptr, tz uintptr) (r int32) TEXT ·Ygettimeofday(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tv+8(FP), AX @@ -6247,6 +7218,8 @@ TEXT ·Ygettimeofday(SB),$32-28 // func Ygetuid(tls *TLS) (r Tuid_t) TEXT ·Ygetuid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetuid(SB) @@ -6256,6 +7229,8 @@ TEXT ·Ygetuid(SB),$16-12 // func Ygetusershell(tls *TLS) (r uintptr) TEXT ·Ygetusershell(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetusershell(SB) @@ -6265,6 +7240,8 @@ TEXT ·Ygetusershell(SB),$16-16 // func Ygetutent(tls *TLS) (r uintptr) TEXT ·Ygetutent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetutent(SB) @@ -6274,6 +7251,8 @@ TEXT ·Ygetutent(SB),$16-16 // func Ygetutid(tls *TLS, ut uintptr) (r uintptr) TEXT ·Ygetutid(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ut+8(FP), AX @@ -6285,6 +7264,8 @@ TEXT ·Ygetutid(SB),$24-24 // func Ygetutline(tls *TLS, ut uintptr) (r uintptr) TEXT ·Ygetutline(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ut+8(FP), AX @@ -6296,6 +7277,8 @@ TEXT ·Ygetutline(SB),$24-24 // func Ygetutxent(tls *TLS) (r uintptr) TEXT ·Ygetutxent(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetutxent(SB) @@ -6305,6 +7288,8 @@ TEXT ·Ygetutxent(SB),$16-16 // func Ygetutxid(tls *TLS, ut uintptr) (r uintptr) TEXT ·Ygetutxid(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ut+8(FP), AX @@ -6316,6 +7301,8 @@ TEXT ·Ygetutxid(SB),$24-24 // func Ygetutxline(tls *TLS, ut uintptr) (r uintptr) TEXT ·Ygetutxline(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ut+8(FP), AX @@ -6327,6 +7314,8 @@ TEXT ·Ygetutxline(SB),$24-24 // func Ygetw(tls *TLS, f uintptr) (r int32) TEXT ·Ygetw(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -6338,6 +7327,8 @@ TEXT ·Ygetw(SB),$24-20 // func Ygetwc(tls *TLS, f uintptr) (r Twint_t) TEXT ·Ygetwc(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -6349,6 +7340,8 @@ TEXT ·Ygetwc(SB),$24-20 // func Ygetwc_unlocked(tls *TLS, f uintptr) (r Twint_t) TEXT ·Ygetwc_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -6360,6 +7353,8 @@ TEXT ·Ygetwc_unlocked(SB),$24-20 // func Ygetwchar(tls *TLS) (r Twint_t) TEXT ·Ygetwchar(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetwchar(SB) @@ -6369,6 +7364,8 @@ TEXT ·Ygetwchar(SB),$16-12 // func Ygetwchar_unlocked(tls *TLS) (r Twint_t) TEXT ·Ygetwchar_unlocked(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xgetwchar_unlocked(SB) @@ -6378,6 +7375,8 @@ TEXT ·Ygetwchar_unlocked(SB),$16-12 // func Ygetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t) (r Tssize_t) TEXT ·Ygetxattr(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -6395,6 +7394,8 @@ TEXT ·Ygetxattr(SB),$48-48 // func Yglob(tls *TLS, pat uintptr, flags int32, errfunc uintptr, g_ uintptr) (r int32) TEXT ·Yglob(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ pat+8(FP), AX @@ -6412,6 +7413,8 @@ TEXT ·Yglob(SB),$48-44 // func Yglobfree(tls *TLS, g_ uintptr) TEXT ·Yglobfree(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ g_+8(FP), AX @@ -6421,6 +7424,8 @@ TEXT ·Yglobfree(SB),$16-16 // func Ygmtime(tls *TLS, t uintptr) (r uintptr) TEXT ·Ygmtime(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -6432,6 +7437,8 @@ TEXT ·Ygmtime(SB),$24-24 // func Ygmtime_r(tls *TLS, t uintptr, tm uintptr) (r uintptr) TEXT ·Ygmtime_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -6445,6 +7452,8 @@ TEXT ·Ygmtime_r(SB),$32-32 // func Ygrantpt(tls *TLS, fd int32) (r int32) TEXT ·Ygrantpt(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -6456,6 +7465,8 @@ TEXT ·Ygrantpt(SB),$24-20 // func Yhasmntopt(tls *TLS, mnt uintptr, opt uintptr) (r uintptr) TEXT ·Yhasmntopt(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ mnt+8(FP), AX @@ -6469,6 +7480,8 @@ TEXT ·Yhasmntopt(SB),$32-32 // func Yhcreate(tls *TLS, nel Tsize_t) (r int32) TEXT ·Yhcreate(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ nel+8(FP), AX @@ -6480,6 +7493,8 @@ TEXT ·Yhcreate(SB),$24-20 // func Yhdestroy(tls *TLS) TEXT ·Yhdestroy(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xhdestroy(SB) @@ -6487,6 +7502,8 @@ TEXT ·Yhdestroy(SB),$8-8 // func Yherror(tls *TLS, msg uintptr) TEXT ·Yherror(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ msg+8(FP), AX @@ -6496,6 +7513,8 @@ TEXT ·Yherror(SB),$16-16 // func Yhsearch(tls *TLS, item TENTRY, action TACTION) (r uintptr) TEXT ·Yhsearch(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ item_Fkey+8(FP), AX @@ -6511,6 +7530,8 @@ TEXT ·Yhsearch(SB),$40-40 // func Yhstrerror(tls *TLS, ecode int32) (r uintptr) TEXT ·Yhstrerror(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL ecode+8(FP), AX @@ -6522,6 +7543,8 @@ TEXT ·Yhstrerror(SB),$24-24 // func Yhtonl(tls *TLS, n Tuint32_t) (r Tuint32_t) TEXT ·Yhtonl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -6533,6 +7556,8 @@ TEXT ·Yhtonl(SB),$24-20 // func Yhtons(tls *TLS, n Tuint16_t) (r Tuint16_t) TEXT ·Yhtons(SB),$24-18 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVW n+8(FP), AX @@ -6544,6 +7569,8 @@ TEXT ·Yhtons(SB),$24-18 // func Yhypot(tls *TLS, x float64, y float64) (r float64) TEXT ·Yhypot(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -6557,6 +7584,8 @@ TEXT ·Yhypot(SB),$32-32 // func Yhypotf(tls *TLS, x float32, y float32) (r float32) TEXT ·Yhypotf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -6570,6 +7599,8 @@ TEXT ·Yhypotf(SB),$24-20 // func Yhypotl(tls *TLS, x float64, y float64) (r float64) TEXT ·Yhypotl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -6583,6 +7614,8 @@ TEXT ·Yhypotl(SB),$32-32 // func Yiconv(tls *TLS, cd Ticonv_t, in uintptr, inb uintptr, out uintptr, outb uintptr) (r Tsize_t) TEXT ·Yiconv(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ cd+8(FP), AX @@ -6602,6 +7635,8 @@ TEXT ·Yiconv(SB),$56-56 // func Yiconv_close(tls *TLS, cd Ticonv_t) (r int32) TEXT ·Yiconv_close(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ cd+8(FP), AX @@ -6613,6 +7648,8 @@ TEXT ·Yiconv_close(SB),$24-20 // func Yiconv_open(tls *TLS, to uintptr, from uintptr) (r Ticonv_t) TEXT ·Yiconv_open(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ to+8(FP), AX @@ -6626,6 +7663,8 @@ TEXT ·Yiconv_open(SB),$32-32 // func Yif_freenameindex(tls *TLS, idx uintptr) TEXT ·Yif_freenameindex(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ idx+8(FP), AX @@ -6635,6 +7674,8 @@ TEXT ·Yif_freenameindex(SB),$16-16 // func Yif_indextoname(tls *TLS, index uint32, name uintptr) (r1 uintptr) TEXT ·Yif_indextoname(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL index+8(FP), AX @@ -6648,6 +7689,8 @@ TEXT ·Yif_indextoname(SB),$32-32 // func Yif_nameindex(tls *TLS) (r uintptr) TEXT ·Yif_nameindex(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xif_nameindex(SB) @@ -6657,6 +7700,8 @@ TEXT ·Yif_nameindex(SB),$16-16 // func Yif_nametoindex(tls *TLS, name uintptr) (r1 uint32) TEXT ·Yif_nametoindex(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -6668,6 +7713,8 @@ TEXT ·Yif_nametoindex(SB),$24-20 // func Yilogb(tls *TLS, x3 float64) (r int32) TEXT ·Yilogb(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -6679,6 +7726,8 @@ TEXT ·Yilogb(SB),$24-20 // func Yilogbf(tls *TLS, x3 float32) (r int32) TEXT ·Yilogbf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -6690,6 +7739,8 @@ TEXT ·Yilogbf(SB),$24-20 // func Yilogbl(tls *TLS, x float64) (r int32) TEXT ·Yilogbl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -6701,6 +7752,8 @@ TEXT ·Yilogbl(SB),$24-20 // func Yimaxabs(tls *TLS, a Tintmax_t) (r Tintmax_t) TEXT ·Yimaxabs(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -6712,6 +7765,8 @@ TEXT ·Yimaxabs(SB),$24-24 // func Yimaxdiv(tls *TLS, num Tintmax_t, den Tintmax_t) (r Timaxdiv_t) TEXT ·Yimaxdiv(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ num+8(FP), AX @@ -6727,6 +7782,8 @@ TEXT ·Yimaxdiv(SB),$40-40 // func Yindex(tls *TLS, s uintptr, c int32) (r uintptr) TEXT ·Yindex(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -6740,6 +7797,8 @@ TEXT ·Yindex(SB),$32-32 // func Yinet_addr(tls *TLS, p uintptr) (r Tin_addr_t) TEXT ·Yinet_addr(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p+8(FP), AX @@ -6751,6 +7810,8 @@ TEXT ·Yinet_addr(SB),$24-20 // func Yinet_aton(tls *TLS, s0 uintptr, dest uintptr) (r int32) TEXT ·Yinet_aton(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s0+8(FP), AX @@ -6764,6 +7825,8 @@ TEXT ·Yinet_aton(SB),$32-28 // func Yinet_lnaof(tls *TLS, in Tin_addr) (r Tin_addr_t) TEXT ·Yinet_lnaof(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL in_Fs_addr+8(FP), AX @@ -6775,6 +7838,8 @@ TEXT ·Yinet_lnaof(SB),$24-20 // func Yinet_makeaddr(tls *TLS, n Tin_addr_t, h Tin_addr_t) (r Tin_addr) TEXT ·Yinet_makeaddr(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -6788,6 +7853,8 @@ TEXT ·Yinet_makeaddr(SB),$24-20 // func Yinet_netof(tls *TLS, in Tin_addr) (r Tin_addr_t) TEXT ·Yinet_netof(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL in_Fs_addr+8(FP), AX @@ -6799,6 +7866,8 @@ TEXT ·Yinet_netof(SB),$24-20 // func Yinet_network(tls *TLS, p uintptr) (r Tin_addr_t) TEXT ·Yinet_network(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p+8(FP), AX @@ -6810,6 +7879,8 @@ TEXT ·Yinet_network(SB),$24-20 // func Yinet_ntoa(tls *TLS, _in Tin_addr) (r uintptr) TEXT ·Yinet_ntoa(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL _in_Fs_addr+8(FP), AX @@ -6821,6 +7892,8 @@ TEXT ·Yinet_ntoa(SB),$24-24 // func Yinet_ntop(tls *TLS, af int32, a0 uintptr, s uintptr, l Tsocklen_t) (r uintptr) TEXT ·Yinet_ntop(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL af+8(FP), AX @@ -6838,6 +7911,8 @@ TEXT ·Yinet_ntop(SB),$48-48 // func Yinet_pton(tls *TLS, af int32, s uintptr, a0 uintptr) (r int32) TEXT ·Yinet_pton(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL af+8(FP), AX @@ -6853,6 +7928,8 @@ TEXT ·Yinet_pton(SB),$40-36 // func Yinit_module(tls *TLS, a uintptr, b uint64, c uintptr) (r int32) TEXT ·Yinit_module(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -6868,6 +7945,8 @@ TEXT ·Yinit_module(SB),$40-36 // func Yinitstate(tls *TLS, seed uint32, state uintptr, size Tsize_t) (r uintptr) TEXT ·Yinitstate(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL seed+8(FP), AX @@ -6883,6 +7962,8 @@ TEXT ·Yinitstate(SB),$40-40 // func Yinitstate_r(t *TLS, seed uint32, statebuf uintptr, statelen Tsize_t, buf uintptr) int32 TEXT ·Yinitstate_r(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVL seed+8(FP), AX @@ -6900,6 +7981,8 @@ TEXT ·Yinitstate_r(SB),$48-44 // func Yinotify_add_watch(tls *TLS, fd int32, pathname uintptr, mask Tuint32_t) (r int32) TEXT ·Yinotify_add_watch(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -6915,6 +7998,8 @@ TEXT ·Yinotify_add_watch(SB),$40-36 // func Yinotify_init(tls *TLS) (r int32) TEXT ·Yinotify_init(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xinotify_init(SB) @@ -6924,6 +8009,8 @@ TEXT ·Yinotify_init(SB),$16-12 // func Yinotify_init1(tls *TLS, flags int32) (r1 int32) TEXT ·Yinotify_init1(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL flags+8(FP), AX @@ -6935,6 +8022,8 @@ TEXT ·Yinotify_init1(SB),$24-20 // func Yinotify_rm_watch(tls *TLS, fd int32, wd int32) (r int32) TEXT ·Yinotify_rm_watch(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -6948,6 +8037,8 @@ TEXT ·Yinotify_rm_watch(SB),$24-20 // func Yinsque(tls *TLS, element uintptr, pred uintptr) TEXT ·Yinsque(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ element+8(FP), AX @@ -6959,6 +8050,8 @@ TEXT ·Yinsque(SB),$24-24 // func Yioctl(tls *TLS, fd int32, req int32, va uintptr) (r1 int32) TEXT ·Yioctl(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -6974,6 +8067,8 @@ TEXT ·Yioctl(SB),$32-28 // func Yioperm(tls *TLS, from uint64, num uint64, turn_on int32) (r int32) TEXT ·Yioperm(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ from+8(FP), AX @@ -6989,6 +8084,8 @@ TEXT ·Yioperm(SB),$40-36 // func Yiopl(tls *TLS, level int32) (r int32) TEXT ·Yiopl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL level+8(FP), AX @@ -7000,6 +8097,8 @@ TEXT ·Yiopl(SB),$24-20 // func Yisalnum(tls *TLS, c int32) (r int32) TEXT ·Yisalnum(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7011,6 +8110,8 @@ TEXT ·Yisalnum(SB),$24-20 // func Yisalnum_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisalnum_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7024,6 +8125,8 @@ TEXT ·Yisalnum_l(SB),$32-28 // func Yisalpha(tls *TLS, c int32) (r int32) TEXT ·Yisalpha(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7035,6 +8138,8 @@ TEXT ·Yisalpha(SB),$24-20 // func Yisalpha_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisalpha_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7048,6 +8153,8 @@ TEXT ·Yisalpha_l(SB),$32-28 // func Yisascii(tls *TLS, c int32) (r int32) TEXT ·Yisascii(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7059,6 +8166,8 @@ TEXT ·Yisascii(SB),$24-20 // func Yisastream(tls *TLS, fd int32) (r int32) TEXT ·Yisastream(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -7070,6 +8179,8 @@ TEXT ·Yisastream(SB),$24-20 // func Yisatty(tls *TLS, fd int32) (r1 int32) TEXT ·Yisatty(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -7081,6 +8192,8 @@ TEXT ·Yisatty(SB),$24-20 // func Yisblank(tls *TLS, c int32) (r int32) TEXT ·Yisblank(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7092,6 +8205,8 @@ TEXT ·Yisblank(SB),$24-20 // func Yisblank_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisblank_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7105,6 +8220,8 @@ TEXT ·Yisblank_l(SB),$32-28 // func Yiscntrl(tls *TLS, c int32) (r int32) TEXT ·Yiscntrl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7116,6 +8233,8 @@ TEXT ·Yiscntrl(SB),$24-20 // func Yiscntrl_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yiscntrl_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7129,6 +8248,8 @@ TEXT ·Yiscntrl_l(SB),$32-28 // func Yisdigit(tls *TLS, c int32) (r int32) TEXT ·Yisdigit(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7140,6 +8261,8 @@ TEXT ·Yisdigit(SB),$24-20 // func Yisdigit_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisdigit_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7153,6 +8276,8 @@ TEXT ·Yisdigit_l(SB),$32-28 // func Yisgraph(tls *TLS, c int32) (r int32) TEXT ·Yisgraph(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7164,6 +8289,8 @@ TEXT ·Yisgraph(SB),$24-20 // func Yisgraph_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisgraph_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7177,6 +8304,8 @@ TEXT ·Yisgraph_l(SB),$32-28 // func Yislower(tls *TLS, c int32) (r int32) TEXT ·Yislower(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7188,6 +8317,8 @@ TEXT ·Yislower(SB),$24-20 // func Yislower_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yislower_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7201,6 +8332,8 @@ TEXT ·Yislower_l(SB),$32-28 // func Yisnan(t *TLS, x float64) int32 TEXT ·Yisnan(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -7212,6 +8345,8 @@ TEXT ·Yisnan(SB),$24-20 // func Yisnanf(t *TLS, arg float32) int32 TEXT ·Yisnanf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVL arg+8(FP), AX @@ -7223,6 +8358,8 @@ TEXT ·Yisnanf(SB),$24-20 // func Yisnanl(t *TLS, arg float64) int32 TEXT ·Yisnanl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ arg+8(FP), AX @@ -7234,6 +8371,8 @@ TEXT ·Yisnanl(SB),$24-20 // func Yisprint(tls *TLS, c int32) (r int32) TEXT ·Yisprint(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7245,6 +8384,8 @@ TEXT ·Yisprint(SB),$24-20 // func Yisprint_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisprint_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7258,6 +8399,8 @@ TEXT ·Yisprint_l(SB),$32-28 // func Yispunct(tls *TLS, c int32) (r int32) TEXT ·Yispunct(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7269,6 +8412,8 @@ TEXT ·Yispunct(SB),$24-20 // func Yispunct_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yispunct_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7282,6 +8427,8 @@ TEXT ·Yispunct_l(SB),$32-28 // func Yissetugid(tls *TLS) (r int32) TEXT ·Yissetugid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xissetugid(SB) @@ -7291,6 +8438,8 @@ TEXT ·Yissetugid(SB),$16-12 // func Yisspace(tls *TLS, c int32) (r int32) TEXT ·Yisspace(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7302,6 +8451,8 @@ TEXT ·Yisspace(SB),$24-20 // func Yisspace_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisspace_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7315,6 +8466,8 @@ TEXT ·Yisspace_l(SB),$32-28 // func Yisupper(tls *TLS, c int32) (r int32) TEXT ·Yisupper(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7326,6 +8479,8 @@ TEXT ·Yisupper(SB),$24-20 // func Yisupper_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisupper_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7339,6 +8494,8 @@ TEXT ·Yisupper_l(SB),$32-28 // func Yiswalnum(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswalnum(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7350,6 +8507,8 @@ TEXT ·Yiswalnum(SB),$24-20 // func Yiswalnum_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswalnum_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7363,6 +8522,8 @@ TEXT ·Yiswalnum_l(SB),$32-28 // func Yiswalpha(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswalpha(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7374,6 +8535,8 @@ TEXT ·Yiswalpha(SB),$24-20 // func Yiswalpha_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswalpha_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7387,6 +8550,8 @@ TEXT ·Yiswalpha_l(SB),$32-28 // func Yiswblank(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswblank(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7398,6 +8563,8 @@ TEXT ·Yiswblank(SB),$24-20 // func Yiswblank_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswblank_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7411,6 +8578,8 @@ TEXT ·Yiswblank_l(SB),$32-28 // func Yiswcntrl(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswcntrl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7422,6 +8591,8 @@ TEXT ·Yiswcntrl(SB),$24-20 // func Yiswcntrl_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswcntrl_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7435,6 +8606,8 @@ TEXT ·Yiswcntrl_l(SB),$32-28 // func Yiswctype(tls *TLS, wc Twint_t, type1 Twctype_t) (r int32) TEXT ·Yiswctype(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7448,6 +8621,8 @@ TEXT ·Yiswctype(SB),$32-28 // func Yiswctype_l(tls *TLS, c Twint_t, t Twctype_t, l Tlocale_t) (r int32) TEXT ·Yiswctype_l(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7463,6 +8638,8 @@ TEXT ·Yiswctype_l(SB),$40-36 // func Yiswdigit(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswdigit(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7474,6 +8651,8 @@ TEXT ·Yiswdigit(SB),$24-20 // func Yiswdigit_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswdigit_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7487,6 +8666,8 @@ TEXT ·Yiswdigit_l(SB),$32-28 // func Yiswgraph(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswgraph(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7498,6 +8679,8 @@ TEXT ·Yiswgraph(SB),$24-20 // func Yiswgraph_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswgraph_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7511,6 +8694,8 @@ TEXT ·Yiswgraph_l(SB),$32-28 // func Yiswlower(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswlower(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7522,6 +8707,8 @@ TEXT ·Yiswlower(SB),$24-20 // func Yiswlower_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswlower_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7535,6 +8722,8 @@ TEXT ·Yiswlower_l(SB),$32-28 // func Yiswprint(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswprint(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7546,6 +8735,8 @@ TEXT ·Yiswprint(SB),$24-20 // func Yiswprint_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswprint_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7559,6 +8750,8 @@ TEXT ·Yiswprint_l(SB),$32-28 // func Yiswpunct(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswpunct(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7570,6 +8763,8 @@ TEXT ·Yiswpunct(SB),$24-20 // func Yiswpunct_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswpunct_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7583,6 +8778,8 @@ TEXT ·Yiswpunct_l(SB),$32-28 // func Yiswspace(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswspace(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7594,6 +8791,8 @@ TEXT ·Yiswspace(SB),$24-20 // func Yiswspace_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswspace_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7607,6 +8806,8 @@ TEXT ·Yiswspace_l(SB),$32-28 // func Yiswupper(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswupper(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7618,6 +8819,8 @@ TEXT ·Yiswupper(SB),$24-20 // func Yiswupper_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswupper_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7631,6 +8834,8 @@ TEXT ·Yiswupper_l(SB),$32-28 // func Yiswxdigit(tls *TLS, wc Twint_t) (r int32) TEXT ·Yiswxdigit(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -7642,6 +8847,8 @@ TEXT ·Yiswxdigit(SB),$24-20 // func Yiswxdigit_l(tls *TLS, c Twint_t, l Tlocale_t) (r int32) TEXT ·Yiswxdigit_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7655,6 +8862,8 @@ TEXT ·Yiswxdigit_l(SB),$32-28 // func Yisxdigit(tls *TLS, c int32) (r int32) TEXT ·Yisxdigit(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7666,6 +8875,8 @@ TEXT ·Yisxdigit(SB),$24-20 // func Yisxdigit_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Yisxdigit_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -7679,6 +8890,8 @@ TEXT ·Yisxdigit_l(SB),$32-28 // func Yj0(tls *TLS, x float64) (r1 float64) TEXT ·Yj0(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -7690,6 +8903,8 @@ TEXT ·Yj0(SB),$24-24 // func Yj0f(tls *TLS, x float32) (r1 float32) TEXT ·Yj0f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -7701,6 +8916,8 @@ TEXT ·Yj0f(SB),$24-20 // func Yj1(tls *TLS, x float64) (r1 float64) TEXT ·Yj1(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -7712,6 +8929,8 @@ TEXT ·Yj1(SB),$24-24 // func Yj1f(tls *TLS, x float32) (r1 float32) TEXT ·Yj1f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -7723,6 +8942,8 @@ TEXT ·Yj1f(SB),$24-20 // func Yjn(tls *TLS, n int32, x float64) (r float64) TEXT ·Yjn(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -7736,6 +8957,8 @@ TEXT ·Yjn(SB),$32-32 // func Yjnf(tls *TLS, n int32, x float32) (r float32) TEXT ·Yjnf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -7749,6 +8972,8 @@ TEXT ·Yjnf(SB),$24-20 // func Yjrand48(tls *TLS, s uintptr) (r int64) TEXT ·Yjrand48(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -7760,6 +8985,8 @@ TEXT ·Yjrand48(SB),$24-24 // func Ykill(tls *TLS, pid Tpid_t, sig int32) (r int32) TEXT ·Ykill(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -7773,6 +9000,8 @@ TEXT ·Ykill(SB),$24-20 // func Ykillpg(tls *TLS, pgid Tpid_t, sig int32) (r int32) TEXT ·Ykillpg(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pgid+8(FP), AX @@ -7786,6 +9015,8 @@ TEXT ·Ykillpg(SB),$24-20 // func Yklogctl(tls *TLS, type1 int32, buf uintptr, len1 int32) (r int32) TEXT ·Yklogctl(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL type1+8(FP), AX @@ -7801,6 +9032,8 @@ TEXT ·Yklogctl(SB),$40-36 // func Yl64a(tls *TLS, x0 int64) (r uintptr) TEXT ·Yl64a(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x0+8(FP), AX @@ -7812,6 +9045,8 @@ TEXT ·Yl64a(SB),$24-24 // func Ylabs(tls *TLS, a int64) (r int64) TEXT ·Ylabs(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -7823,6 +9058,8 @@ TEXT ·Ylabs(SB),$24-24 // func Ylchmod(tls *TLS, path uintptr, mode Tmode_t) (r int32) TEXT ·Ylchmod(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -7836,6 +9073,8 @@ TEXT ·Ylchmod(SB),$32-28 // func Ylchown(tls *TLS, path uintptr, uid Tuid_t, gid Tgid_t) (r int32) TEXT ·Ylchown(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -7851,6 +9090,8 @@ TEXT ·Ylchown(SB),$32-28 // func Ylckpwdf(tls *TLS) (r int32) TEXT ·Ylckpwdf(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xlckpwdf(SB) @@ -7860,6 +9101,8 @@ TEXT ·Ylckpwdf(SB),$16-12 // func Ylcong48(tls *TLS, p uintptr) TEXT ·Ylcong48(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p+8(FP), AX @@ -7869,6 +9112,8 @@ TEXT ·Ylcong48(SB),$16-16 // func Yldexp(tls *TLS, x float64, n int32) (r float64) TEXT ·Yldexp(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -7882,6 +9127,8 @@ TEXT ·Yldexp(SB),$32-32 // func Yldexpf(tls *TLS, x float32, n int32) (r float32) TEXT ·Yldexpf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -7895,6 +9142,8 @@ TEXT ·Yldexpf(SB),$24-20 // func Yldexpl(tls *TLS, x float64, n int32) (r float64) TEXT ·Yldexpl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -7908,6 +9157,8 @@ TEXT ·Yldexpl(SB),$32-32 // func Yldiv(tls *TLS, num int64, den int64) (r Tldiv_t) TEXT ·Yldiv(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ num+8(FP), AX @@ -7923,6 +9174,8 @@ TEXT ·Yldiv(SB),$40-40 // func Ylfind(tls *TLS, key uintptr, base uintptr, nelp uintptr, width Tsize_t, compar uintptr) (r uintptr) TEXT ·Ylfind(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -7942,6 +9195,8 @@ TEXT ·Ylfind(SB),$56-56 // func Ylgamma(tls *TLS, x float64) (r float64) TEXT ·Ylgamma(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -7953,6 +9208,8 @@ TEXT ·Ylgamma(SB),$24-24 // func Ylgamma_r(tls *TLS, x float64, signgamp uintptr) (r float64) TEXT ·Ylgamma_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -7966,6 +9223,8 @@ TEXT ·Ylgamma_r(SB),$32-32 // func Ylgammaf(tls *TLS, x float32) (r float32) TEXT ·Ylgammaf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -7977,6 +9236,8 @@ TEXT ·Ylgammaf(SB),$24-20 // func Ylgammaf_r(tls *TLS, x float32, signgamp uintptr) (r float32) TEXT ·Ylgammaf_r(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -7990,6 +9251,8 @@ TEXT ·Ylgammaf_r(SB),$32-28 // func Ylgammal(tls *TLS, x float64) (r float64) TEXT ·Ylgammal(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8001,6 +9264,8 @@ TEXT ·Ylgammal(SB),$24-24 // func Ylgammal_r(tls *TLS, x float64, sg uintptr) (r float64) TEXT ·Ylgammal_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8014,6 +9279,8 @@ TEXT ·Ylgammal_r(SB),$32-32 // func Ylgetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t) (r Tssize_t) TEXT ·Ylgetxattr(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -8031,6 +9298,8 @@ TEXT ·Ylgetxattr(SB),$48-48 // func Ylink(tls *TLS, existing uintptr, new1 uintptr) (r int32) TEXT ·Ylink(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ existing+8(FP), AX @@ -8044,6 +9313,8 @@ TEXT ·Ylink(SB),$32-28 // func Ylinkat(tls *TLS, fd1 int32, existing uintptr, fd2 int32, new1 uintptr, flag int32) (r int32) TEXT ·Ylinkat(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd1+8(FP), AX @@ -8063,6 +9334,8 @@ TEXT ·Ylinkat(SB),$56-52 // func Ylisten(tls *TLS, fd int32, backlog int32) (r1 int32) TEXT ·Ylisten(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -8076,6 +9349,8 @@ TEXT ·Ylisten(SB),$24-20 // func Ylistxattr(tls *TLS, path uintptr, list uintptr, size Tsize_t) (r Tssize_t) TEXT ·Ylistxattr(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -8091,6 +9366,8 @@ TEXT ·Ylistxattr(SB),$40-40 // func Yllabs(tls *TLS, a int64) (r int64) TEXT ·Yllabs(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -8102,6 +9379,8 @@ TEXT ·Yllabs(SB),$24-24 // func Ylldiv(tls *TLS, num int64, den int64) (r Tlldiv_t) TEXT ·Ylldiv(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ num+8(FP), AX @@ -8117,6 +9396,8 @@ TEXT ·Ylldiv(SB),$40-40 // func Yllistxattr(tls *TLS, path uintptr, list uintptr, size Tsize_t) (r Tssize_t) TEXT ·Yllistxattr(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -8132,6 +9413,8 @@ TEXT ·Yllistxattr(SB),$40-40 // func Yllrint(tls *TLS, x float64) (r int64) TEXT ·Yllrint(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8143,6 +9426,8 @@ TEXT ·Yllrint(SB),$24-24 // func Yllrintf(tls *TLS, x float32) (r int64) TEXT ·Yllrintf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -8154,6 +9439,8 @@ TEXT ·Yllrintf(SB),$24-24 // func Yllrintl(tls *TLS, x float64) (r int64) TEXT ·Yllrintl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8165,6 +9452,8 @@ TEXT ·Yllrintl(SB),$24-24 // func Yllround(tls *TLS, x float64) (r int64) TEXT ·Yllround(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8176,6 +9465,8 @@ TEXT ·Yllround(SB),$24-24 // func Yllroundf(tls *TLS, x float32) (r int64) TEXT ·Yllroundf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -8187,6 +9478,8 @@ TEXT ·Yllroundf(SB),$24-24 // func Yllroundl(tls *TLS, x float64) (r int64) TEXT ·Yllroundl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8198,6 +9491,8 @@ TEXT ·Yllroundl(SB),$24-24 // func Ylocaleconv(tls *TLS) (r uintptr) TEXT ·Ylocaleconv(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xlocaleconv(SB) @@ -8207,6 +9502,8 @@ TEXT ·Ylocaleconv(SB),$16-16 // func Ylocaltime(tls *TLS, t uintptr) (r uintptr) TEXT ·Ylocaltime(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -8218,6 +9515,8 @@ TEXT ·Ylocaltime(SB),$24-24 // func Ylocaltime_r(tls *TLS, t uintptr, tm uintptr) (r uintptr) TEXT ·Ylocaltime_r(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -8231,6 +9530,8 @@ TEXT ·Ylocaltime_r(SB),$32-32 // func Ylockf(tls *TLS, fd int32, op int32, size Toff_t) (r int32) TEXT ·Ylockf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -8246,6 +9547,8 @@ TEXT ·Ylockf(SB),$32-28 // func Ylog(tls *TLS, x1 float64) (r1 float64) TEXT ·Ylog(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x1+8(FP), AX @@ -8257,6 +9560,8 @@ TEXT ·Ylog(SB),$24-24 // func Ylog10(tls *TLS, x float64) (r float64) TEXT ·Ylog10(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8268,6 +9573,8 @@ TEXT ·Ylog10(SB),$24-24 // func Ylog10f(tls *TLS, x float32) (r float32) TEXT ·Ylog10f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -8279,6 +9586,8 @@ TEXT ·Ylog10f(SB),$24-20 // func Ylog10l(tls *TLS, x float64) (r float64) TEXT ·Ylog10l(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8290,6 +9599,8 @@ TEXT ·Ylog10l(SB),$24-24 // func Ylog1p(tls *TLS, x3 float64) (r float64) TEXT ·Ylog1p(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -8301,6 +9612,8 @@ TEXT ·Ylog1p(SB),$24-24 // func Ylog1pf(tls *TLS, x3 float32) (r float32) TEXT ·Ylog1pf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -8312,6 +9625,8 @@ TEXT ·Ylog1pf(SB),$24-20 // func Ylog1pl(tls *TLS, x float64) (r float64) TEXT ·Ylog1pl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8323,6 +9638,8 @@ TEXT ·Ylog1pl(SB),$24-24 // func Ylog2(tls *TLS, x1 float64) (r1 float64) TEXT ·Ylog2(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x1+8(FP), AX @@ -8334,6 +9651,8 @@ TEXT ·Ylog2(SB),$24-24 // func Ylog2f(tls *TLS, x1 float32) (r1 float32) TEXT ·Ylog2f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x1+8(FP), AX @@ -8345,6 +9664,8 @@ TEXT ·Ylog2f(SB),$24-20 // func Ylog2l(tls *TLS, x float64) (r float64) TEXT ·Ylog2l(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8356,6 +9677,8 @@ TEXT ·Ylog2l(SB),$24-24 // func Ylogb(tls *TLS, x float64) (r float64) TEXT ·Ylogb(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8367,6 +9690,8 @@ TEXT ·Ylogb(SB),$24-24 // func Ylogbf(tls *TLS, x float32) (r float32) TEXT ·Ylogbf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -8378,6 +9703,8 @@ TEXT ·Ylogbf(SB),$24-20 // func Ylogbl(tls *TLS, x float64) (r float64) TEXT ·Ylogbl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8389,6 +9716,8 @@ TEXT ·Ylogbl(SB),$24-24 // func Ylogf(tls *TLS, x1 float32) (r1 float32) TEXT ·Ylogf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x1+8(FP), AX @@ -8400,6 +9729,8 @@ TEXT ·Ylogf(SB),$24-20 // func Ylogin_tty(tls *TLS, fd int32) (r int32) TEXT ·Ylogin_tty(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -8411,6 +9742,8 @@ TEXT ·Ylogin_tty(SB),$24-20 // func Ylogl(tls *TLS, x float64) (r float64) TEXT ·Ylogl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8422,6 +9755,8 @@ TEXT ·Ylogl(SB),$24-24 // func Ylongjmp(t *TLS, env uintptr, val int32) TEXT ·Ylongjmp(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ env+8(FP), AX @@ -8433,6 +9768,8 @@ TEXT ·Ylongjmp(SB),$24-20 // func Ylrand48(tls *TLS) (r int64) TEXT ·Ylrand48(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xlrand48(SB) @@ -8442,6 +9779,8 @@ TEXT ·Ylrand48(SB),$16-16 // func Ylremovexattr(tls *TLS, path uintptr, name uintptr) (r int32) TEXT ·Ylremovexattr(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -8455,6 +9794,8 @@ TEXT ·Ylremovexattr(SB),$32-28 // func Ylrint(tls *TLS, x float64) (r int64) TEXT ·Ylrint(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8466,6 +9807,8 @@ TEXT ·Ylrint(SB),$24-24 // func Ylrintf(tls *TLS, x float32) (r int64) TEXT ·Ylrintf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -8477,6 +9820,8 @@ TEXT ·Ylrintf(SB),$24-24 // func Ylrintl(tls *TLS, x float64) (r int64) TEXT ·Ylrintl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8488,6 +9833,8 @@ TEXT ·Ylrintl(SB),$24-24 // func Ylround(tls *TLS, x float64) (r int64) TEXT ·Ylround(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8499,6 +9846,8 @@ TEXT ·Ylround(SB),$24-24 // func Ylroundf(tls *TLS, x float32) (r int64) TEXT ·Ylroundf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -8510,6 +9859,8 @@ TEXT ·Ylroundf(SB),$24-24 // func Ylroundl(tls *TLS, x float64) (r int64) TEXT ·Ylroundl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -8521,6 +9872,8 @@ TEXT ·Ylroundl(SB),$24-24 // func Ylsearch(tls *TLS, key uintptr, base uintptr, nelp uintptr, width Tsize_t, compar uintptr) (r uintptr) TEXT ·Ylsearch(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -8540,6 +9893,8 @@ TEXT ·Ylsearch(SB),$56-56 // func Ylseek(tls *TLS, fd int32, offset Toff_t, whence int32) (r Toff_t) TEXT ·Ylseek(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -8555,6 +9910,8 @@ TEXT ·Ylseek(SB),$40-40 // func Ylseek64(tls *TLS, fd int32, offset Toff_t, whence int32) (r Toff_t) TEXT ·Ylseek64(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -8570,6 +9927,8 @@ TEXT ·Ylseek64(SB),$40-40 // func Ylsetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t, flags int32) (r int32) TEXT ·Ylsetxattr(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -8589,6 +9948,8 @@ TEXT ·Ylsetxattr(SB),$56-52 // func Ylstat(tls *TLS, path uintptr, buf uintptr) (r int32) TEXT ·Ylstat(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -8602,6 +9963,8 @@ TEXT ·Ylstat(SB),$32-28 // func Ylstat64(tls *TLS, path uintptr, buf uintptr) (r int32) TEXT ·Ylstat64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -8615,6 +9978,8 @@ TEXT ·Ylstat64(SB),$32-28 // func Ylutimes(tls *TLS, filename uintptr, tv uintptr) (r int32) TEXT ·Ylutimes(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -8628,6 +9993,8 @@ TEXT ·Ylutimes(SB),$32-28 // func Ymadvise(tls *TLS, addr uintptr, len1 Tsize_t, advice int32) (r int32) TEXT ·Ymadvise(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -8643,6 +10010,8 @@ TEXT ·Ymadvise(SB),$40-36 // func Ymalloc(tls *TLS, n Tsize_t) (r uintptr) TEXT ·Ymalloc(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ n+8(FP), AX @@ -8654,6 +10023,8 @@ TEXT ·Ymalloc(SB),$24-24 // func Ymalloc_usable_size(tls *TLS, p uintptr) (r Tsize_t) TEXT ·Ymalloc_usable_size(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p+8(FP), AX @@ -8665,6 +10036,8 @@ TEXT ·Ymalloc_usable_size(SB),$24-24 // func Ymblen(tls *TLS, s uintptr, n Tsize_t) (r int32) TEXT ·Ymblen(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -8678,6 +10051,8 @@ TEXT ·Ymblen(SB),$32-28 // func Ymbrlen(tls *TLS, s uintptr, n Tsize_t, st uintptr) (r Tsize_t) TEXT ·Ymbrlen(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -8693,6 +10068,8 @@ TEXT ·Ymbrlen(SB),$40-40 // func Ymbrtoc16(tls *TLS, pc16 uintptr, s uintptr, n Tsize_t, ps uintptr) (r Tsize_t) TEXT ·Ymbrtoc16(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ pc16+8(FP), AX @@ -8710,6 +10087,8 @@ TEXT ·Ymbrtoc16(SB),$48-48 // func Ymbrtoc32(tls *TLS, pc32 uintptr, s uintptr, n Tsize_t, ps uintptr) (r Tsize_t) TEXT ·Ymbrtoc32(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ pc32+8(FP), AX @@ -8727,6 +10106,8 @@ TEXT ·Ymbrtoc32(SB),$48-48 // func Ymbrtowc(tls *TLS, wc uintptr, src uintptr, n Tsize_t, st uintptr) (r Tsize_t) TEXT ·Ymbrtowc(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ wc+8(FP), AX @@ -8744,6 +10125,8 @@ TEXT ·Ymbrtowc(SB),$48-48 // func Ymbsinit(tls *TLS, st uintptr) (r int32) TEXT ·Ymbsinit(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ st+8(FP), AX @@ -8755,6 +10138,8 @@ TEXT ·Ymbsinit(SB),$24-20 // func Ymbsnrtowcs(tls *TLS, wcs uintptr, src uintptr, n Tsize_t, wn Tsize_t, st uintptr) (r Tsize_t) TEXT ·Ymbsnrtowcs(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ wcs+8(FP), AX @@ -8774,6 +10159,8 @@ TEXT ·Ymbsnrtowcs(SB),$56-56 // func Ymbsrtowcs(tls *TLS, ws uintptr, src uintptr, wn Tsize_t, st uintptr) (r Tsize_t) TEXT ·Ymbsrtowcs(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ws+8(FP), AX @@ -8791,6 +10178,8 @@ TEXT ·Ymbsrtowcs(SB),$48-48 // func Ymbstowcs(tls *TLS, ws uintptr, _s uintptr, wn Tsize_t) (r Tsize_t) TEXT ·Ymbstowcs(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ws+8(FP), AX @@ -8806,6 +10195,8 @@ TEXT ·Ymbstowcs(SB),$40-40 // func Ymbtowc(tls *TLS, wc uintptr, src uintptr, n Tsize_t) (r int32) TEXT ·Ymbtowc(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ wc+8(FP), AX @@ -8821,6 +10212,8 @@ TEXT ·Ymbtowc(SB),$40-36 // func Ymemccpy(tls *TLS, dest uintptr, src uintptr, c int32, n Tsize_t) (r uintptr) TEXT ·Ymemccpy(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -8838,6 +10231,8 @@ TEXT ·Ymemccpy(SB),$48-48 // func Ymemchr(tls *TLS, src uintptr, c int32, n Tsize_t) (r uintptr) TEXT ·Ymemchr(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ src+8(FP), AX @@ -8853,6 +10248,8 @@ TEXT ·Ymemchr(SB),$40-40 // func Ymemcmp(tls *TLS, vl uintptr, vr uintptr, n Tsize_t) (r1 int32) TEXT ·Ymemcmp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ vl+8(FP), AX @@ -8868,6 +10265,8 @@ TEXT ·Ymemcmp(SB),$40-36 // func Ymemcpy(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r uintptr) TEXT ·Ymemcpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -8883,6 +10282,8 @@ TEXT ·Ymemcpy(SB),$40-40 // func Ymemfd_create(tls *TLS, name uintptr, flags uint32) (r int32) TEXT ·Ymemfd_create(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -8896,6 +10297,8 @@ TEXT ·Ymemfd_create(SB),$32-28 // func Ymemmem(tls *TLS, h0 uintptr, k Tsize_t, n0 uintptr, l Tsize_t) (r uintptr) TEXT ·Ymemmem(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ h0+8(FP), AX @@ -8913,6 +10316,8 @@ TEXT ·Ymemmem(SB),$48-48 // func Ymemmove(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r uintptr) TEXT ·Ymemmove(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -8928,6 +10333,8 @@ TEXT ·Ymemmove(SB),$40-40 // func Ymempcpy(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r uintptr) TEXT ·Ymempcpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -8943,6 +10350,8 @@ TEXT ·Ymempcpy(SB),$40-40 // func Ymemrchr(tls *TLS, m uintptr, c int32, n Tsize_t) (r uintptr) TEXT ·Ymemrchr(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ m+8(FP), AX @@ -8958,6 +10367,8 @@ TEXT ·Ymemrchr(SB),$40-40 // func Ymemset(tls *TLS, dest uintptr, c int32, n Tsize_t) (r uintptr) TEXT ·Ymemset(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -8973,6 +10384,8 @@ TEXT ·Ymemset(SB),$40-40 // func Ymincore(tls *TLS, addr uintptr, len1 Tsize_t, vec uintptr) (r int32) TEXT ·Ymincore(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -8988,6 +10401,8 @@ TEXT ·Ymincore(SB),$40-36 // func Ymkdir(tls *TLS, path uintptr, mode Tmode_t) (r int32) TEXT ·Ymkdir(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -9001,6 +10416,8 @@ TEXT ·Ymkdir(SB),$32-28 // func Ymkdirat(tls *TLS, fd int32, path uintptr, mode Tmode_t) (r int32) TEXT ·Ymkdirat(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -9016,6 +10433,8 @@ TEXT ·Ymkdirat(SB),$40-36 // func Ymkdtemp(tls *TLS, template uintptr) (r uintptr) TEXT ·Ymkdtemp(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9027,6 +10446,8 @@ TEXT ·Ymkdtemp(SB),$24-24 // func Ymkfifo(tls *TLS, path uintptr, mode Tmode_t) (r int32) TEXT ·Ymkfifo(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -9040,6 +10461,8 @@ TEXT ·Ymkfifo(SB),$32-28 // func Ymkfifoat(tls *TLS, fd int32, path uintptr, mode Tmode_t) (r int32) TEXT ·Ymkfifoat(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -9055,6 +10478,8 @@ TEXT ·Ymkfifoat(SB),$40-36 // func Ymknod(tls *TLS, path uintptr, mode Tmode_t, dev Tdev_t) (r int32) TEXT ·Ymknod(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -9070,6 +10495,8 @@ TEXT ·Ymknod(SB),$40-36 // func Ymknodat(tls *TLS, fd int32, path uintptr, mode Tmode_t, dev Tdev_t) (r int32) TEXT ·Ymknodat(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -9087,6 +10514,8 @@ TEXT ·Ymknodat(SB),$48-44 // func Ymkostemp(tls *TLS, template uintptr, flags int32) (r int32) TEXT ·Ymkostemp(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9100,6 +10529,8 @@ TEXT ·Ymkostemp(SB),$32-28 // func Ymkostemps(tls *TLS, template uintptr, len1 int32, flags int32) (r int32) TEXT ·Ymkostemps(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9115,6 +10546,8 @@ TEXT ·Ymkostemps(SB),$32-28 // func Ymkstemp(tls *TLS, template uintptr) (r int32) TEXT ·Ymkstemp(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9126,6 +10559,8 @@ TEXT ·Ymkstemp(SB),$24-20 // func Ymkstemp64(tls *TLS, template uintptr) (r int32) TEXT ·Ymkstemp64(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9137,6 +10572,8 @@ TEXT ·Ymkstemp64(SB),$24-20 // func Ymkstemps(tls *TLS, template uintptr, len1 int32) (r int32) TEXT ·Ymkstemps(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9150,6 +10587,8 @@ TEXT ·Ymkstemps(SB),$32-28 // func Ymkstemps64(tls *TLS, template uintptr, len1 int32) (r int32) TEXT ·Ymkstemps64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9163,6 +10602,8 @@ TEXT ·Ymkstemps64(SB),$32-28 // func Ymktemp(tls *TLS, template uintptr) (r uintptr) TEXT ·Ymktemp(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ template+8(FP), AX @@ -9174,6 +10615,8 @@ TEXT ·Ymktemp(SB),$24-24 // func Ymktime(tls *TLS, tm uintptr) (r Ttime_t) TEXT ·Ymktime(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tm+8(FP), AX @@ -9185,6 +10628,8 @@ TEXT ·Ymktime(SB),$24-24 // func Ymlock(tls *TLS, addr uintptr, len1 Tsize_t) (r int32) TEXT ·Ymlock(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -9198,6 +10643,8 @@ TEXT ·Ymlock(SB),$32-28 // func Ymlock2(tls *TLS, addr uintptr, len1 Tsize_t, flags uint32) (r int32) TEXT ·Ymlock2(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -9213,6 +10660,8 @@ TEXT ·Ymlock2(SB),$40-36 // func Ymlockall(tls *TLS, flags int32) (r int32) TEXT ·Ymlockall(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL flags+8(FP), AX @@ -9224,6 +10673,8 @@ TEXT ·Ymlockall(SB),$24-20 // func Ymmap(tls *TLS, start uintptr, len1 Tsize_t, prot int32, flags int32, fd int32, off Toff_t) (r uintptr) TEXT ·Ymmap(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ start+8(FP), AX @@ -9245,6 +10696,8 @@ TEXT ·Ymmap(SB),$56-56 // func Ymmap64(tls *TLS, start uintptr, len1 Tsize_t, prot int32, flags int32, fd int32, off Toff_t) (r uintptr) TEXT ·Ymmap64(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ start+8(FP), AX @@ -9266,6 +10719,8 @@ TEXT ·Ymmap64(SB),$56-56 // func Ymodf(tls *TLS, x float64, iptr uintptr) (r float64) TEXT ·Ymodf(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -9279,6 +10734,8 @@ TEXT ·Ymodf(SB),$32-32 // func Ymodff(tls *TLS, x float32, iptr uintptr) (r float32) TEXT ·Ymodff(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -9292,6 +10749,8 @@ TEXT ·Ymodff(SB),$32-28 // func Ymodfl(tls *TLS, x float64, iptr uintptr) (r1 float64) TEXT ·Ymodfl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -9305,6 +10764,8 @@ TEXT ·Ymodfl(SB),$32-32 // func Ymount(tls *TLS, special uintptr, dir uintptr, fstype uintptr, flags uint64, data uintptr) (r int32) TEXT ·Ymount(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ special+8(FP), AX @@ -9324,6 +10785,8 @@ TEXT ·Ymount(SB),$56-52 // func Ymprotect(tls *TLS, addr uintptr, len1 Tsize_t, prot int32) (r int32) TEXT ·Ymprotect(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -9339,6 +10802,8 @@ TEXT ·Ymprotect(SB),$40-36 // func Ymrand48(tls *TLS) (r int64) TEXT ·Ymrand48(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xmrand48(SB) @@ -9348,6 +10813,8 @@ TEXT ·Ymrand48(SB),$16-16 // func Ymremap(tls *TLS, old_addr uintptr, old_len Tsize_t, new_len Tsize_t, flags int32, va uintptr) (r uintptr) TEXT ·Ymremap(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ old_addr+8(FP), AX @@ -9367,6 +10834,8 @@ TEXT ·Ymremap(SB),$56-56 // func Ymsgctl(tls *TLS, q int32, cmd int32, buf uintptr) (r1 int32) TEXT ·Ymsgctl(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL q+8(FP), AX @@ -9382,6 +10851,8 @@ TEXT ·Ymsgctl(SB),$32-28 // func Ymsgget(tls *TLS, k Tkey_t, flag int32) (r int32) TEXT ·Ymsgget(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL k+8(FP), AX @@ -9395,6 +10866,8 @@ TEXT ·Ymsgget(SB),$24-20 // func Ymsgrcv(tls *TLS, q int32, m uintptr, len1 Tsize_t, type1 int64, flag int32) (r Tssize_t) TEXT ·Ymsgrcv(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL q+8(FP), AX @@ -9414,6 +10887,8 @@ TEXT ·Ymsgrcv(SB),$56-56 // func Ymsgsnd(tls *TLS, q int32, m uintptr, len1 Tsize_t, flag int32) (r int32) TEXT ·Ymsgsnd(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL q+8(FP), AX @@ -9431,6 +10906,8 @@ TEXT ·Ymsgsnd(SB),$48-44 // func Ymsync(tls *TLS, start uintptr, len1 Tsize_t, flags int32) (r int32) TEXT ·Ymsync(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ start+8(FP), AX @@ -9446,6 +10923,8 @@ TEXT ·Ymsync(SB),$40-36 // func Ymunlock(tls *TLS, addr uintptr, len1 Tsize_t) (r int32) TEXT ·Ymunlock(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -9459,6 +10938,8 @@ TEXT ·Ymunlock(SB),$32-28 // func Ymunlockall(tls *TLS) (r int32) TEXT ·Ymunlockall(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xmunlockall(SB) @@ -9468,6 +10949,8 @@ TEXT ·Ymunlockall(SB),$16-12 // func Ymunmap(tls *TLS, start uintptr, len1 Tsize_t) (r int32) TEXT ·Ymunmap(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ start+8(FP), AX @@ -9481,6 +10964,8 @@ TEXT ·Ymunmap(SB),$32-28 // func Yname_to_handle_at(tls *TLS, dirfd int32, pathname uintptr, handle uintptr, mount_id uintptr, flags int32) (r int32) TEXT ·Yname_to_handle_at(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL dirfd+8(FP), AX @@ -9500,6 +10985,8 @@ TEXT ·Yname_to_handle_at(SB),$56-52 // func Ynan(tls *TLS, s uintptr) (r float64) TEXT ·Ynan(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -9511,6 +10998,8 @@ TEXT ·Ynan(SB),$24-24 // func Ynanf(tls *TLS, s uintptr) (r float32) TEXT ·Ynanf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -9522,6 +11011,8 @@ TEXT ·Ynanf(SB),$24-20 // func Ynanl(tls *TLS, s uintptr) (r float64) TEXT ·Ynanl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -9533,6 +11024,8 @@ TEXT ·Ynanl(SB),$24-24 // func Ynanosleep(tls *TLS, req uintptr, rem uintptr) (r int32) TEXT ·Ynanosleep(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ req+8(FP), AX @@ -9546,6 +11039,8 @@ TEXT ·Ynanosleep(SB),$32-28 // func Ynewlocale(tls *TLS, mask int32, name uintptr, loc Tlocale_t) (r Tlocale_t) TEXT ·Ynewlocale(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL mask+8(FP), AX @@ -9561,6 +11056,8 @@ TEXT ·Ynewlocale(SB),$40-40 // func Ynextafter(tls *TLS, x3 float64, y3 float64) (r float64) TEXT ·Ynextafter(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -9574,6 +11071,8 @@ TEXT ·Ynextafter(SB),$32-32 // func Ynextafterf(tls *TLS, x3 float32, y3 float32) (r float32) TEXT ·Ynextafterf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -9587,6 +11086,8 @@ TEXT ·Ynextafterf(SB),$24-20 // func Ynextafterl(tls *TLS, x float64, y float64) (r float64) TEXT ·Ynextafterl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -9600,6 +11101,8 @@ TEXT ·Ynextafterl(SB),$32-32 // func Ynexttoward(tls *TLS, x float64, y float64) (r float64) TEXT ·Ynexttoward(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -9613,6 +11116,8 @@ TEXT ·Ynexttoward(SB),$32-32 // func Ynexttowardf(tls *TLS, x3 float32, y3 float64) (r float32) TEXT ·Ynexttowardf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -9626,6 +11131,8 @@ TEXT ·Ynexttowardf(SB),$32-28 // func Ynexttowardl(tls *TLS, x float64, y float64) (r float64) TEXT ·Ynexttowardl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -9639,6 +11146,8 @@ TEXT ·Ynexttowardl(SB),$32-32 // func Ynftw(tls *TLS, path uintptr, fn uintptr, fd_limit int32, flags int32) (r1 int32) TEXT ·Ynftw(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -9656,6 +11165,8 @@ TEXT ·Ynftw(SB),$40-36 // func Yngettext(tls *TLS, msgid1 uintptr, msgid2 uintptr, n uint64) (r uintptr) TEXT ·Yngettext(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ msgid1+8(FP), AX @@ -9671,6 +11182,8 @@ TEXT ·Yngettext(SB),$40-40 // func Ynice(tls *TLS, inc int32) (r int32) TEXT ·Ynice(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL inc+8(FP), AX @@ -9682,6 +11195,8 @@ TEXT ·Ynice(SB),$24-20 // func Ynl_langinfo(tls *TLS, item Tnl_item) (r uintptr) TEXT ·Ynl_langinfo(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL item+8(FP), AX @@ -9693,6 +11208,8 @@ TEXT ·Ynl_langinfo(SB),$24-24 // func Ynl_langinfo_l(tls *TLS, item Tnl_item, loc Tlocale_t) (r uintptr) TEXT ·Ynl_langinfo_l(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL item+8(FP), AX @@ -9706,6 +11223,8 @@ TEXT ·Ynl_langinfo_l(SB),$32-32 // func Ynrand48(tls *TLS, s uintptr) (r int64) TEXT ·Ynrand48(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -9717,6 +11236,8 @@ TEXT ·Ynrand48(SB),$24-24 // func Yns_get16(tls *TLS, cp uintptr) (r uint32) TEXT ·Yns_get16(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ cp+8(FP), AX @@ -9728,6 +11249,8 @@ TEXT ·Yns_get16(SB),$24-20 // func Yns_get32(tls *TLS, cp uintptr) (r uint64) TEXT ·Yns_get32(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ cp+8(FP), AX @@ -9739,6 +11262,8 @@ TEXT ·Yns_get32(SB),$24-24 // func Yns_initparse(tls *TLS, msg uintptr, msglen int32, handle uintptr) (r1 int32) TEXT ·Yns_initparse(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ msg+8(FP), AX @@ -9754,6 +11279,8 @@ TEXT ·Yns_initparse(SB),$40-36 // func Yns_name_uncompress(tls *TLS, msg uintptr, eom uintptr, src uintptr, dst uintptr, dstsiz Tsize_t) (r1 int32) TEXT ·Yns_name_uncompress(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ msg+8(FP), AX @@ -9773,6 +11300,8 @@ TEXT ·Yns_name_uncompress(SB),$56-52 // func Yns_parserr(tls *TLS, handle uintptr, section Tns_sect, rrnum int32, rr uintptr) (r1 int32) TEXT ·Yns_parserr(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ handle+8(FP), AX @@ -9790,6 +11319,8 @@ TEXT ·Yns_parserr(SB),$40-36 // func Yns_put16(tls *TLS, s uint32, cp uintptr) TEXT ·Yns_put16(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL s+8(FP), AX @@ -9801,6 +11332,8 @@ TEXT ·Yns_put16(SB),$24-24 // func Yns_put32(tls *TLS, l uint64, cp uintptr) TEXT ·Yns_put32(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -9812,6 +11345,8 @@ TEXT ·Yns_put32(SB),$24-24 // func Yns_skiprr(tls *TLS, ptr uintptr, eom uintptr, section Tns_sect, count int32) (r1 int32) TEXT ·Yns_skiprr(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ptr+8(FP), AX @@ -9829,6 +11364,8 @@ TEXT ·Yns_skiprr(SB),$40-36 // func Yntohl(tls *TLS, n Tuint32_t) (r Tuint32_t) TEXT ·Yntohl(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -9840,6 +11377,8 @@ TEXT ·Yntohl(SB),$24-20 // func Yntohs(tls *TLS, n Tuint16_t) (r Tuint16_t) TEXT ·Yntohs(SB),$24-18 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVW n+8(FP), AX @@ -9851,6 +11390,8 @@ TEXT ·Yntohs(SB),$24-18 // func Yobstack_free(t *TLS, obstack, obj uintptr) TEXT ·Yobstack_free(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ obstack+8(FP), AX @@ -9862,6 +11403,8 @@ TEXT ·Yobstack_free(SB),$24-24 // func Yobstack_vprintf(t *TLS, obstack, template, va uintptr) int32 TEXT ·Yobstack_vprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ obstack+8(FP), AX @@ -9877,6 +11420,8 @@ TEXT ·Yobstack_vprintf(SB),$40-36 // func Yopen(tls *TLS, filename uintptr, flags int32, va uintptr) (r int32) TEXT ·Yopen(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -9892,6 +11437,8 @@ TEXT ·Yopen(SB),$40-36 // func Yopen64(tls *TLS, filename uintptr, flags int32, va uintptr) (r int32) TEXT ·Yopen64(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -9907,6 +11454,8 @@ TEXT ·Yopen64(SB),$40-36 // func Yopen_by_handle_at(tls *TLS, mount_fd int32, handle uintptr, flags int32) (r int32) TEXT ·Yopen_by_handle_at(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL mount_fd+8(FP), AX @@ -9922,6 +11471,8 @@ TEXT ·Yopen_by_handle_at(SB),$40-36 // func Yopen_memstream(tls *TLS, bufp uintptr, sizep uintptr) (r uintptr) TEXT ·Yopen_memstream(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ bufp+8(FP), AX @@ -9935,6 +11486,8 @@ TEXT ·Yopen_memstream(SB),$32-32 // func Yopen_wmemstream(tls *TLS, bufp uintptr, sizep uintptr) (r uintptr) TEXT ·Yopen_wmemstream(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ bufp+8(FP), AX @@ -9948,6 +11501,8 @@ TEXT ·Yopen_wmemstream(SB),$32-32 // func Yopenat(tls *TLS, fd int32, filename uintptr, flags int32, va uintptr) (r int32) TEXT ·Yopenat(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -9965,6 +11520,8 @@ TEXT ·Yopenat(SB),$48-44 // func Yopendir(tls *TLS, name uintptr) (r uintptr) TEXT ·Yopendir(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -9976,6 +11533,8 @@ TEXT ·Yopendir(SB),$24-24 // func Yopenlog(tls *TLS, ident uintptr, opt int32, facility int32) TEXT ·Yopenlog(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ident+8(FP), AX @@ -9989,6 +11548,8 @@ TEXT ·Yopenlog(SB),$24-24 // func Yopenpty(tls *TLS, pm uintptr, ps uintptr, name uintptr, tio uintptr, ws uintptr) (r int32) TEXT ·Yopenpty(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ pm+8(FP), AX @@ -10008,6 +11569,8 @@ TEXT ·Yopenpty(SB),$56-52 // func Ypathconf(tls *TLS, path uintptr, name int32) (r int64) TEXT ·Ypathconf(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -10021,6 +11584,8 @@ TEXT ·Ypathconf(SB),$32-32 // func Ypause(tls *TLS) (r int32) TEXT ·Ypause(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xpause(SB) @@ -10030,6 +11595,8 @@ TEXT ·Ypause(SB),$16-12 // func Ypclose(tls *TLS, f uintptr) (r1 int32) TEXT ·Ypclose(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -10041,6 +11608,8 @@ TEXT ·Ypclose(SB),$24-20 // func Yperror(tls *TLS, msg uintptr) TEXT ·Yperror(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ msg+8(FP), AX @@ -10050,6 +11619,8 @@ TEXT ·Yperror(SB),$16-16 // func Ypersonality(tls *TLS, persona uint64) (r int32) TEXT ·Ypersonality(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ persona+8(FP), AX @@ -10061,6 +11632,8 @@ TEXT ·Ypersonality(SB),$24-20 // func Ypipe(tls *TLS, fd uintptr) (r int32) TEXT ·Ypipe(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fd+8(FP), AX @@ -10072,6 +11645,8 @@ TEXT ·Ypipe(SB),$24-20 // func Ypipe2(tls *TLS, fd uintptr, flag int32) (r int32) TEXT ·Ypipe2(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fd+8(FP), AX @@ -10085,6 +11660,8 @@ TEXT ·Ypipe2(SB),$32-28 // func Ypivot_root(tls *TLS, new1 uintptr, old uintptr) (r int32) TEXT ·Ypivot_root(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ new1+8(FP), AX @@ -10098,6 +11675,8 @@ TEXT ·Ypivot_root(SB),$32-28 // func Ypoll(tls *TLS, fds uintptr, n Tnfds_t, timeout int32) (r int32) TEXT ·Ypoll(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fds+8(FP), AX @@ -10113,6 +11692,8 @@ TEXT ·Ypoll(SB),$40-36 // func Ypopen(t *TLS, command, type1 uintptr) uintptr TEXT ·Ypopen(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ command+8(FP), AX @@ -10126,6 +11707,8 @@ TEXT ·Ypopen(SB),$32-32 // func Yposix_close(tls *TLS, fd int32, flags int32) (r int32) TEXT ·Yposix_close(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -10139,6 +11722,8 @@ TEXT ·Yposix_close(SB),$24-20 // func Yposix_fadvise(tls *TLS, fd int32, base Toff_t, len1 Toff_t, advice int32) (r int32) TEXT ·Yposix_fadvise(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -10156,6 +11741,8 @@ TEXT ·Yposix_fadvise(SB),$48-44 // func Yposix_fallocate(tls *TLS, fd int32, base Toff_t, len1 Toff_t) (r int32) TEXT ·Yposix_fallocate(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -10171,6 +11758,8 @@ TEXT ·Yposix_fallocate(SB),$40-36 // func Yposix_madvise(tls *TLS, addr uintptr, len1 Tsize_t, advice int32) (r int32) TEXT ·Yposix_madvise(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -10186,6 +11775,8 @@ TEXT ·Yposix_madvise(SB),$40-36 // func Yposix_openpt(tls *TLS, flags int32) (r1 int32) TEXT ·Yposix_openpt(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL flags+8(FP), AX @@ -10197,6 +11788,8 @@ TEXT ·Yposix_openpt(SB),$24-20 // func Yposix_spawn_file_actions_addchdir_np(tls *TLS, fa uintptr, path uintptr) (r int32) TEXT ·Yposix_spawn_file_actions_addchdir_np(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fa+8(FP), AX @@ -10210,6 +11803,8 @@ TEXT ·Yposix_spawn_file_actions_addchdir_np(SB),$32-28 // func Yposix_spawn_file_actions_addclose(tls *TLS, fa uintptr, fd int32) (r int32) TEXT ·Yposix_spawn_file_actions_addclose(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fa+8(FP), AX @@ -10223,6 +11818,8 @@ TEXT ·Yposix_spawn_file_actions_addclose(SB),$32-28 // func Yposix_spawn_file_actions_adddup2(tls *TLS, fa uintptr, srcfd int32, fd int32) (r int32) TEXT ·Yposix_spawn_file_actions_adddup2(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fa+8(FP), AX @@ -10238,6 +11835,8 @@ TEXT ·Yposix_spawn_file_actions_adddup2(SB),$32-28 // func Yposix_spawn_file_actions_addfchdir_np(tls *TLS, fa uintptr, fd int32) (r int32) TEXT ·Yposix_spawn_file_actions_addfchdir_np(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fa+8(FP), AX @@ -10251,6 +11850,8 @@ TEXT ·Yposix_spawn_file_actions_addfchdir_np(SB),$32-28 // func Yposix_spawn_file_actions_addopen(tls *TLS, fa uintptr, fd int32, path uintptr, flags int32, mode Tmode_t) (r int32) TEXT ·Yposix_spawn_file_actions_addopen(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fa+8(FP), AX @@ -10270,6 +11871,8 @@ TEXT ·Yposix_spawn_file_actions_addopen(SB),$48-44 // func Yposix_spawn_file_actions_destroy(tls *TLS, fa uintptr) (r int32) TEXT ·Yposix_spawn_file_actions_destroy(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fa+8(FP), AX @@ -10281,6 +11884,8 @@ TEXT ·Yposix_spawn_file_actions_destroy(SB),$24-20 // func Yposix_spawn_file_actions_init(tls *TLS, fa uintptr) (r int32) TEXT ·Yposix_spawn_file_actions_init(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fa+8(FP), AX @@ -10292,6 +11897,8 @@ TEXT ·Yposix_spawn_file_actions_init(SB),$24-20 // func Yposix_spawnattr_destroy(tls *TLS, attr uintptr) (r int32) TEXT ·Yposix_spawnattr_destroy(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10303,6 +11910,8 @@ TEXT ·Yposix_spawnattr_destroy(SB),$24-20 // func Yposix_spawnattr_getflags(tls *TLS, attr uintptr, flags uintptr) (r int32) TEXT ·Yposix_spawnattr_getflags(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10316,6 +11925,8 @@ TEXT ·Yposix_spawnattr_getflags(SB),$32-28 // func Yposix_spawnattr_getpgroup(tls *TLS, attr uintptr, pgrp uintptr) (r int32) TEXT ·Yposix_spawnattr_getpgroup(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10329,6 +11940,8 @@ TEXT ·Yposix_spawnattr_getpgroup(SB),$32-28 // func Yposix_spawnattr_getschedparam(tls *TLS, attr uintptr, schedparam uintptr) (r int32) TEXT ·Yposix_spawnattr_getschedparam(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10342,6 +11955,8 @@ TEXT ·Yposix_spawnattr_getschedparam(SB),$32-28 // func Yposix_spawnattr_getschedpolicy(tls *TLS, attr uintptr, policy uintptr) (r int32) TEXT ·Yposix_spawnattr_getschedpolicy(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10355,6 +11970,8 @@ TEXT ·Yposix_spawnattr_getschedpolicy(SB),$32-28 // func Yposix_spawnattr_getsigdefault(tls *TLS, attr uintptr, def uintptr) (r int32) TEXT ·Yposix_spawnattr_getsigdefault(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10368,6 +11985,8 @@ TEXT ·Yposix_spawnattr_getsigdefault(SB),$32-28 // func Yposix_spawnattr_getsigmask(tls *TLS, attr uintptr, mask uintptr) (r int32) TEXT ·Yposix_spawnattr_getsigmask(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10381,6 +12000,8 @@ TEXT ·Yposix_spawnattr_getsigmask(SB),$32-28 // func Yposix_spawnattr_init(tls *TLS, attr uintptr) (r int32) TEXT ·Yposix_spawnattr_init(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10392,6 +12013,8 @@ TEXT ·Yposix_spawnattr_init(SB),$24-20 // func Yposix_spawnattr_setflags(tls *TLS, attr uintptr, flags int16) (r int32) TEXT ·Yposix_spawnattr_setflags(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10405,6 +12028,8 @@ TEXT ·Yposix_spawnattr_setflags(SB),$32-28 // func Yposix_spawnattr_setpgroup(tls *TLS, attr uintptr, pgrp Tpid_t) (r int32) TEXT ·Yposix_spawnattr_setpgroup(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10418,6 +12043,8 @@ TEXT ·Yposix_spawnattr_setpgroup(SB),$32-28 // func Yposix_spawnattr_setschedparam(tls *TLS, attr uintptr, schedparam uintptr) (r int32) TEXT ·Yposix_spawnattr_setschedparam(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10431,6 +12058,8 @@ TEXT ·Yposix_spawnattr_setschedparam(SB),$32-28 // func Yposix_spawnattr_setschedpolicy(tls *TLS, attr uintptr, policy int32) (r int32) TEXT ·Yposix_spawnattr_setschedpolicy(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10444,6 +12073,8 @@ TEXT ·Yposix_spawnattr_setschedpolicy(SB),$32-28 // func Yposix_spawnattr_setsigdefault(tls *TLS, attr uintptr, def uintptr) (r int32) TEXT ·Yposix_spawnattr_setsigdefault(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10457,6 +12088,8 @@ TEXT ·Yposix_spawnattr_setsigdefault(SB),$32-28 // func Yposix_spawnattr_setsigmask(tls *TLS, attr uintptr, mask uintptr) (r int32) TEXT ·Yposix_spawnattr_setsigmask(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ attr+8(FP), AX @@ -10470,6 +12103,8 @@ TEXT ·Yposix_spawnattr_setsigmask(SB),$32-28 // func Ypow(tls *TLS, x1 float64, y1 float64) (r float64) TEXT ·Ypow(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x1+8(FP), AX @@ -10483,6 +12118,8 @@ TEXT ·Ypow(SB),$32-32 // func Ypow10(tls *TLS, x float64) (r float64) TEXT ·Ypow10(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -10494,6 +12131,8 @@ TEXT ·Ypow10(SB),$24-24 // func Ypow10f(tls *TLS, x float32) (r float32) TEXT ·Ypow10f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -10505,6 +12144,8 @@ TEXT ·Ypow10f(SB),$24-20 // func Ypow10l(tls *TLS, x float64) (r float64) TEXT ·Ypow10l(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -10516,6 +12157,8 @@ TEXT ·Ypow10l(SB),$24-24 // func Ypowf(tls *TLS, x1 float32, y1 float32) (r float32) TEXT ·Ypowf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x1+8(FP), AX @@ -10529,6 +12172,8 @@ TEXT ·Ypowf(SB),$24-20 // func Ypowl(tls *TLS, x float64, y float64) (r float64) TEXT ·Ypowl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -10542,6 +12187,8 @@ TEXT ·Ypowl(SB),$32-32 // func Yppoll(tls *TLS, fds uintptr, n Tnfds_t, to uintptr, mask uintptr) (r int32) TEXT ·Yppoll(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fds+8(FP), AX @@ -10559,6 +12206,8 @@ TEXT ·Yppoll(SB),$48-44 // func Yprctl(tls *TLS, op int32, va uintptr) (r int32) TEXT ·Yprctl(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL op+8(FP), AX @@ -10572,6 +12221,8 @@ TEXT ·Yprctl(SB),$32-28 // func Ypread(tls *TLS, fd int32, buf uintptr, size Tsize_t, ofs Toff_t) (r Tssize_t) TEXT ·Ypread(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -10589,6 +12240,8 @@ TEXT ·Ypread(SB),$48-48 // func Ypreadv(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t) (r Tssize_t) TEXT ·Ypreadv(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -10606,6 +12259,8 @@ TEXT ·Ypreadv(SB),$48-48 // func Ypreadv2(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t, flags int32) (r Tssize_t) TEXT ·Ypreadv2(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -10625,6 +12280,8 @@ TEXT ·Ypreadv2(SB),$56-56 // func Yprintf(tls *TLS, fmt uintptr, va uintptr) (r int32) TEXT ·Yprintf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -10638,6 +12295,8 @@ TEXT ·Yprintf(SB),$32-28 // func Yprlimit(tls *TLS, pid Tpid_t, resource int32, new_limit uintptr, old_limit uintptr) (r1 int32) TEXT ·Yprlimit(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -10655,6 +12314,8 @@ TEXT ·Yprlimit(SB),$40-36 // func Yprocess_vm_readv(tls *TLS, pid Tpid_t, lvec uintptr, liovcnt uint64, rvec uintptr, riovcnt uint64, flags uint64) (r Tssize_t) TEXT ·Yprocess_vm_readv(SB),$64-64 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -10676,6 +12337,8 @@ TEXT ·Yprocess_vm_readv(SB),$64-64 // func Yprocess_vm_writev(tls *TLS, pid Tpid_t, lvec uintptr, liovcnt uint64, rvec uintptr, riovcnt uint64, flags uint64) (r Tssize_t) TEXT ·Yprocess_vm_writev(SB),$64-64 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -10697,6 +12360,8 @@ TEXT ·Yprocess_vm_writev(SB),$64-64 // func Ypselect(tls *TLS, n int32, rfds uintptr, wfds uintptr, efds uintptr, ts uintptr, mask uintptr) (r int32) TEXT ·Ypselect(SB),$64-60 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -10718,6 +12383,8 @@ TEXT ·Ypselect(SB),$64-60 // func Ypsiginfo(tls *TLS, si uintptr, msg uintptr) TEXT ·Ypsiginfo(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ si+8(FP), AX @@ -10729,6 +12396,8 @@ TEXT ·Ypsiginfo(SB),$24-24 // func Ypsignal(tls *TLS, sig int32, msg uintptr) TEXT ·Ypsignal(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL sig+8(FP), AX @@ -10740,6 +12409,8 @@ TEXT ·Ypsignal(SB),$24-24 // func Ypthread_atfork(tls *TLS, prepare, parent, child uintptr) int32 TEXT ·Ypthread_atfork(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ prepare+8(FP), AX @@ -10755,6 +12426,8 @@ TEXT ·Ypthread_atfork(SB),$40-36 // func Ypthread_attr_destroy(tls *TLS, a uintptr) int32 TEXT ·Ypthread_attr_destroy(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -10766,6 +12439,8 @@ TEXT ·Ypthread_attr_destroy(SB),$24-20 // func Ypthread_attr_getdetachstate(tls *TLS, a uintptr, state uintptr) int32 TEXT ·Ypthread_attr_getdetachstate(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -10779,6 +12454,8 @@ TEXT ·Ypthread_attr_getdetachstate(SB),$32-28 // func Ypthread_attr_init(tls *TLS, a uintptr) int32 TEXT ·Ypthread_attr_init(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -10790,6 +12467,8 @@ TEXT ·Ypthread_attr_init(SB),$24-20 // func Ypthread_attr_setdetachstate(tls *TLS, a uintptr, state int32) (r int32) TEXT ·Ypthread_attr_setdetachstate(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -10803,6 +12482,8 @@ TEXT ·Ypthread_attr_setdetachstate(SB),$32-28 // func Ypthread_attr_setscope(tls *TLS, a uintptr, scope int32) int32 TEXT ·Ypthread_attr_setscope(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -10816,6 +12497,8 @@ TEXT ·Ypthread_attr_setscope(SB),$32-28 // func Ypthread_attr_setstacksize(tls *TLS, a uintptr, stacksite Tsize_t) int32 TEXT ·Ypthread_attr_setstacksize(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -10829,6 +12512,8 @@ TEXT ·Ypthread_attr_setstacksize(SB),$32-28 // func Ypthread_cleanup_pop(tls *TLS, run int32) TEXT ·Ypthread_cleanup_pop(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL run+8(FP), AX @@ -10838,6 +12523,8 @@ TEXT ·Ypthread_cleanup_pop(SB),$16-12 // func Ypthread_cleanup_push(tls *TLS, f, x uintptr) TEXT ·Ypthread_cleanup_push(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -10849,6 +12536,8 @@ TEXT ·Ypthread_cleanup_push(SB),$24-24 // func Ypthread_cond_broadcast(tls *TLS, c uintptr) int32 TEXT ·Ypthread_cond_broadcast(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ c+8(FP), AX @@ -10860,6 +12549,8 @@ TEXT ·Ypthread_cond_broadcast(SB),$24-20 // func Ypthread_cond_destroy(tls *TLS, c uintptr) int32 TEXT ·Ypthread_cond_destroy(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ c+8(FP), AX @@ -10871,6 +12562,8 @@ TEXT ·Ypthread_cond_destroy(SB),$24-20 // func Ypthread_cond_init(tls *TLS, c, a uintptr) int32 TEXT ·Ypthread_cond_init(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ c+8(FP), AX @@ -10884,6 +12577,8 @@ TEXT ·Ypthread_cond_init(SB),$32-28 // func Ypthread_cond_signal(tls *TLS, c uintptr) int32 TEXT ·Ypthread_cond_signal(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ c+8(FP), AX @@ -10895,6 +12590,8 @@ TEXT ·Ypthread_cond_signal(SB),$24-20 // func Ypthread_cond_timedwait(tls *TLS, c, m, ts uintptr) (r int32) TEXT ·Ypthread_cond_timedwait(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ c+8(FP), AX @@ -10910,6 +12607,8 @@ TEXT ·Ypthread_cond_timedwait(SB),$40-36 // func Ypthread_cond_wait(tls *TLS, c, m uintptr) int32 TEXT ·Ypthread_cond_wait(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ c+8(FP), AX @@ -10923,6 +12622,8 @@ TEXT ·Ypthread_cond_wait(SB),$32-28 // func Ypthread_create(tls *TLS, res, attrp, entry, arg uintptr) int32 TEXT ·Ypthread_create(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ res+8(FP), AX @@ -10940,6 +12641,8 @@ TEXT ·Ypthread_create(SB),$48-44 // func Ypthread_detach(tls *TLS, t uintptr) int32 TEXT ·Ypthread_detach(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -10951,6 +12654,8 @@ TEXT ·Ypthread_detach(SB),$24-20 // func Ypthread_equal(tls *TLS, t, u uintptr) int32 TEXT ·Ypthread_equal(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -10964,6 +12669,8 @@ TEXT ·Ypthread_equal(SB),$32-28 // func Ypthread_exit(tls *TLS, result uintptr) TEXT ·Ypthread_exit(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ result+8(FP), AX @@ -10973,6 +12680,8 @@ TEXT ·Ypthread_exit(SB),$16-16 // func Ypthread_getspecific(tls *TLS, k Tpthread_key_t) uintptr TEXT ·Ypthread_getspecific(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL k+8(FP), AX @@ -10984,6 +12693,8 @@ TEXT ·Ypthread_getspecific(SB),$24-24 // func Ypthread_join(tls *TLS, t Tpthread_t, res uintptr) (r int32) TEXT ·Ypthread_join(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -10997,6 +12708,8 @@ TEXT ·Ypthread_join(SB),$32-28 // func Ypthread_key_create(tls *TLS, k uintptr, dtor uintptr) int32 TEXT ·Ypthread_key_create(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ k+8(FP), AX @@ -11010,6 +12723,8 @@ TEXT ·Ypthread_key_create(SB),$32-28 // func Ypthread_key_delete(tls *TLS, k Tpthread_key_t) int32 TEXT ·Ypthread_key_delete(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL k+8(FP), AX @@ -11021,6 +12736,8 @@ TEXT ·Ypthread_key_delete(SB),$24-20 // func Ypthread_mutex_destroy(tls *TLS, m uintptr) int32 TEXT ·Ypthread_mutex_destroy(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ m+8(FP), AX @@ -11032,6 +12749,8 @@ TEXT ·Ypthread_mutex_destroy(SB),$24-20 // func Ypthread_mutex_init(tls *TLS, m, a uintptr) int32 TEXT ·Ypthread_mutex_init(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ m+8(FP), AX @@ -11045,6 +12764,8 @@ TEXT ·Ypthread_mutex_init(SB),$32-28 // func Ypthread_mutex_lock(tls *TLS, m uintptr) int32 TEXT ·Ypthread_mutex_lock(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ m+8(FP), AX @@ -11056,6 +12777,8 @@ TEXT ·Ypthread_mutex_lock(SB),$24-20 // func Ypthread_mutex_trylock(tls *TLS, m uintptr) int32 TEXT ·Ypthread_mutex_trylock(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ m+8(FP), AX @@ -11067,6 +12790,8 @@ TEXT ·Ypthread_mutex_trylock(SB),$24-20 // func Ypthread_mutex_unlock(tls *TLS, m uintptr) int32 TEXT ·Ypthread_mutex_unlock(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ m+8(FP), AX @@ -11078,6 +12803,8 @@ TEXT ·Ypthread_mutex_unlock(SB),$24-20 // func Ypthread_mutexattr_destroy(tls *TLS, a uintptr) int32 TEXT ·Ypthread_mutexattr_destroy(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -11089,6 +12816,8 @@ TEXT ·Ypthread_mutexattr_destroy(SB),$24-20 // func Ypthread_mutexattr_init(tls *TLS, a uintptr) int32 TEXT ·Ypthread_mutexattr_init(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -11100,6 +12829,8 @@ TEXT ·Ypthread_mutexattr_init(SB),$24-20 // func Ypthread_mutexattr_settype(tls *TLS, a uintptr, typ int32) int32 TEXT ·Ypthread_mutexattr_settype(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -11113,6 +12844,8 @@ TEXT ·Ypthread_mutexattr_settype(SB),$32-28 // func Ypthread_self(tls *TLS) uintptr TEXT ·Ypthread_self(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xpthread_self(SB) @@ -11122,6 +12855,8 @@ TEXT ·Ypthread_self(SB),$16-16 // func Ypthread_setcancelstate(tls *TLS, new int32, old uintptr) int32 TEXT ·Ypthread_setcancelstate(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL new+8(FP), AX @@ -11135,6 +12870,8 @@ TEXT ·Ypthread_setcancelstate(SB),$32-28 // func Ypthread_setspecific(tls *TLS, k Tpthread_key_t, x uintptr) int32 TEXT ·Ypthread_setspecific(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL k+8(FP), AX @@ -11148,6 +12885,8 @@ TEXT ·Ypthread_setspecific(SB),$32-28 // func Ypthread_sigmask(tls *TLS, now int32, set, old uintptr) int32 TEXT ·Ypthread_sigmask(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL now+8(FP), AX @@ -11163,6 +12902,8 @@ TEXT ·Ypthread_sigmask(SB),$40-36 // func Yptrace(tls *TLS, req int32, va uintptr) (r int64) TEXT ·Yptrace(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL req+8(FP), AX @@ -11176,6 +12917,8 @@ TEXT ·Yptrace(SB),$32-32 // func Yptsname(tls *TLS, fd int32) (r uintptr) TEXT ·Yptsname(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11187,6 +12930,8 @@ TEXT ·Yptsname(SB),$24-24 // func Yptsname_r(tls *TLS, fd int32, buf uintptr, len1 Tsize_t) (r int32) TEXT ·Yptsname_r(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11202,6 +12947,8 @@ TEXT ·Yptsname_r(SB),$40-36 // func Yputc(tls *TLS, c1 int32, f1 uintptr) (r int32) TEXT ·Yputc(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c1+8(FP), AX @@ -11215,6 +12962,8 @@ TEXT ·Yputc(SB),$32-28 // func Yputc_unlocked(tls *TLS, c int32, f uintptr) (r int32) TEXT ·Yputc_unlocked(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -11228,6 +12977,8 @@ TEXT ·Yputc_unlocked(SB),$32-28 // func Yputchar(tls *TLS, c1 int32) (r int32) TEXT ·Yputchar(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c1+8(FP), AX @@ -11239,6 +12990,8 @@ TEXT ·Yputchar(SB),$24-20 // func Yputchar_unlocked(tls *TLS, c int32) (r int32) TEXT ·Yputchar_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -11250,6 +13003,8 @@ TEXT ·Yputchar_unlocked(SB),$24-20 // func Yputenv(tls *TLS, s uintptr) (r int32) TEXT ·Yputenv(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -11261,6 +13016,8 @@ TEXT ·Yputenv(SB),$24-20 // func Yputgrent(tls *TLS, gr uintptr, f uintptr) (r1 int32) TEXT ·Yputgrent(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ gr+8(FP), AX @@ -11274,6 +13031,8 @@ TEXT ·Yputgrent(SB),$32-28 // func Yputpwent(tls *TLS, pw uintptr, f uintptr) (r int32) TEXT ·Yputpwent(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ pw+8(FP), AX @@ -11287,6 +13046,8 @@ TEXT ·Yputpwent(SB),$32-28 // func Yputs(tls *TLS, s uintptr) (r1 int32) TEXT ·Yputs(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -11298,6 +13059,8 @@ TEXT ·Yputs(SB),$24-20 // func Yputspent(tls *TLS, sp uintptr, f uintptr) (r int32) TEXT ·Yputspent(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ sp+8(FP), AX @@ -11311,6 +13074,8 @@ TEXT ·Yputspent(SB),$32-28 // func Ypututline(tls *TLS, ut uintptr) (r uintptr) TEXT ·Ypututline(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ut+8(FP), AX @@ -11322,6 +13087,8 @@ TEXT ·Ypututline(SB),$24-24 // func Ypututxline(tls *TLS, ut uintptr) (r uintptr) TEXT ·Ypututxline(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ut+8(FP), AX @@ -11333,6 +13100,8 @@ TEXT ·Ypututxline(SB),$24-24 // func Yputw(tls *TLS, _x int32, f uintptr) (r int32) TEXT ·Yputw(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL _x+8(FP), AX @@ -11346,6 +13115,8 @@ TEXT ·Yputw(SB),$32-28 // func Yputwc(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) TEXT ·Yputwc(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -11359,6 +13130,8 @@ TEXT ·Yputwc(SB),$32-28 // func Yputwc_unlocked(tls *TLS, c Twchar_t, f uintptr) (r Twint_t) TEXT ·Yputwc_unlocked(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -11372,6 +13145,8 @@ TEXT ·Yputwc_unlocked(SB),$32-28 // func Yputwchar(tls *TLS, c Twchar_t) (r Twint_t) TEXT ·Yputwchar(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -11383,6 +13158,8 @@ TEXT ·Yputwchar(SB),$24-20 // func Yputwchar_unlocked(tls *TLS, c Twchar_t) (r Twint_t) TEXT ·Yputwchar_unlocked(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -11394,6 +13171,8 @@ TEXT ·Yputwchar_unlocked(SB),$24-20 // func Ypwrite(tls *TLS, fd int32, buf uintptr, size Tsize_t, ofs Toff_t) (r Tssize_t) TEXT ·Ypwrite(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11411,6 +13190,8 @@ TEXT ·Ypwrite(SB),$48-48 // func Ypwritev(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t) (r Tssize_t) TEXT ·Ypwritev(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11428,6 +13209,8 @@ TEXT ·Ypwritev(SB),$48-48 // func Ypwritev2(tls *TLS, fd int32, iov uintptr, count int32, ofs Toff_t, flags int32) (r Tssize_t) TEXT ·Ypwritev2(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11447,6 +13230,8 @@ TEXT ·Ypwritev2(SB),$56-56 // func Yqsort(tls *TLS, base uintptr, nel Tsize_t, width Tsize_t, cmp Tcmpfun) TEXT ·Yqsort(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ base+8(FP), AX @@ -11462,6 +13247,8 @@ TEXT ·Yqsort(SB),$40-40 // func Yqsort_r(tls *TLS, base uintptr, nel Tsize_t, width Tsize_t, cmp Tcmpfun, arg uintptr) TEXT ·Yqsort_r(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ base+8(FP), AX @@ -11479,6 +13266,8 @@ TEXT ·Yqsort_r(SB),$48-48 // func Yquick_exit(tls *TLS, code int32) TEXT ·Yquick_exit(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL code+8(FP), AX @@ -11488,6 +13277,8 @@ TEXT ·Yquick_exit(SB),$16-12 // func Yquotactl(tls *TLS, cmd int32, special uintptr, id int32, addr uintptr) (r int32) TEXT ·Yquotactl(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL cmd+8(FP), AX @@ -11505,6 +13296,8 @@ TEXT ·Yquotactl(SB),$48-44 // func Yraise(tls *TLS, sig int32) (r int32) TEXT ·Yraise(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL sig+8(FP), AX @@ -11516,6 +13309,8 @@ TEXT ·Yraise(SB),$24-20 // func Yrand(tls *TLS) (r int32) TEXT ·Yrand(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xrand(SB) @@ -11525,6 +13320,8 @@ TEXT ·Yrand(SB),$16-12 // func Yrand_r(tls *TLS, seed uintptr) (r int32) TEXT ·Yrand_r(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ seed+8(FP), AX @@ -11536,6 +13333,8 @@ TEXT ·Yrand_r(SB),$24-20 // func Yrandom(tls *TLS) (r int64) TEXT ·Yrandom(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xrandom(SB) @@ -11545,6 +13344,8 @@ TEXT ·Yrandom(SB),$16-16 // func Yrandom_r(t *TLS, buf, result uintptr) int32 TEXT ·Yrandom_r(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ buf+8(FP), AX @@ -11558,6 +13359,8 @@ TEXT ·Yrandom_r(SB),$32-28 // func Yread(tls *TLS, fd int32, buf uintptr, count Tsize_t) (r Tssize_t) TEXT ·Yread(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11573,6 +13376,8 @@ TEXT ·Yread(SB),$40-40 // func Yreadahead(tls *TLS, fd int32, pos Toff_t, len1 Tsize_t) (r Tssize_t) TEXT ·Yreadahead(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11588,6 +13393,8 @@ TEXT ·Yreadahead(SB),$40-40 // func Yreaddir(tls *TLS, dir uintptr) (r uintptr) TEXT ·Yreaddir(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -11599,6 +13406,8 @@ TEXT ·Yreaddir(SB),$24-24 // func Yreaddir64(tls *TLS, dir uintptr) (r uintptr) TEXT ·Yreaddir64(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -11610,6 +13419,8 @@ TEXT ·Yreaddir64(SB),$24-24 // func Yreaddir_r(tls *TLS, dir uintptr, buf uintptr, result uintptr) (r int32) TEXT ·Yreaddir_r(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -11625,6 +13436,8 @@ TEXT ·Yreaddir_r(SB),$40-36 // func Yreadlink(tls *TLS, path uintptr, buf uintptr, bufsize Tsize_t) (r1 Tssize_t) TEXT ·Yreadlink(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -11640,6 +13453,8 @@ TEXT ·Yreadlink(SB),$40-40 // func Yreadlinkat(tls *TLS, fd int32, path uintptr, buf uintptr, bufsize Tsize_t) (r1 Tssize_t) TEXT ·Yreadlinkat(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11657,6 +13472,8 @@ TEXT ·Yreadlinkat(SB),$48-48 // func Yreadv(tls *TLS, fd int32, iov uintptr, count int32) (r Tssize_t) TEXT ·Yreadv(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11672,6 +13489,8 @@ TEXT ·Yreadv(SB),$40-40 // func Yrealloc(tls *TLS, p uintptr, n Tsize_t) (r uintptr) TEXT ·Yrealloc(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ p+8(FP), AX @@ -11685,6 +13504,8 @@ TEXT ·Yrealloc(SB),$32-32 // func Yreallocarray(tls *TLS, ptr uintptr, m Tsize_t, n Tsize_t) (r uintptr) TEXT ·Yreallocarray(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ptr+8(FP), AX @@ -11700,6 +13521,8 @@ TEXT ·Yreallocarray(SB),$40-40 // func Yrealpath(tls *TLS, filename uintptr, resolved uintptr) (r uintptr) TEXT ·Yrealpath(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ filename+8(FP), AX @@ -11713,6 +13536,8 @@ TEXT ·Yrealpath(SB),$32-32 // func Yreboot(tls *TLS, type1 int32) (r int32) TEXT ·Yreboot(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL type1+8(FP), AX @@ -11724,6 +13549,8 @@ TEXT ·Yreboot(SB),$24-20 // func Yrecv(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32) (r Tssize_t) TEXT ·Yrecv(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11741,6 +13568,8 @@ TEXT ·Yrecv(SB),$48-48 // func Yrecvfrom(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32, addr uintptr, alen uintptr) (r1 Tssize_t) TEXT ·Yrecvfrom(SB),$64-64 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11762,6 +13591,8 @@ TEXT ·Yrecvfrom(SB),$64-64 // func Yrecvmmsg(tls *TLS, fd int32, msgvec uintptr, vlen uint32, flags uint32, timeout uintptr) (r int32) TEXT ·Yrecvmmsg(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11781,6 +13612,8 @@ TEXT ·Yrecvmmsg(SB),$48-44 // func Yrecvmsg(tls *TLS, fd int32, msg uintptr, flags int32) (r2 Tssize_t) TEXT ·Yrecvmsg(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -11796,6 +13629,8 @@ TEXT ·Yrecvmsg(SB),$40-40 // func Yregcomp(tls *TLS, preg uintptr, regex uintptr, cflags int32) (r int32) TEXT ·Yregcomp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ preg+8(FP), AX @@ -11811,6 +13646,8 @@ TEXT ·Yregcomp(SB),$40-36 // func Yregerror(tls *TLS, e int32, preg uintptr, buf uintptr, size Tsize_t) (r Tsize_t) TEXT ·Yregerror(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL e+8(FP), AX @@ -11828,6 +13665,8 @@ TEXT ·Yregerror(SB),$48-48 // func Yregexec(tls *TLS, preg uintptr, string1 uintptr, nmatch Tsize_t, pmatch uintptr, eflags int32) (r int32) TEXT ·Yregexec(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ preg+8(FP), AX @@ -11847,6 +13686,8 @@ TEXT ·Yregexec(SB),$56-52 // func Yregfree(tls *TLS, preg uintptr) TEXT ·Yregfree(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ preg+8(FP), AX @@ -11856,6 +13697,8 @@ TEXT ·Yregfree(SB),$16-16 // func Yremainder(tls *TLS, x float64, y float64) (r float64) TEXT ·Yremainder(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -11869,6 +13712,8 @@ TEXT ·Yremainder(SB),$32-32 // func Yremainderf(tls *TLS, x float32, y float32) (r float32) TEXT ·Yremainderf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -11882,6 +13727,8 @@ TEXT ·Yremainderf(SB),$24-20 // func Yremainderl(tls *TLS, x float64, y float64) (r float64) TEXT ·Yremainderl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -11895,6 +13742,8 @@ TEXT ·Yremainderl(SB),$32-32 // func Yremap_file_pages(tls *TLS, addr uintptr, size Tsize_t, prot int32, pgoff Tsize_t, flags int32) (r int32) TEXT ·Yremap_file_pages(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -11914,6 +13763,8 @@ TEXT ·Yremap_file_pages(SB),$56-52 // func Yremove(tls *TLS, path uintptr) (r1 int32) TEXT ·Yremove(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -11925,6 +13776,8 @@ TEXT ·Yremove(SB),$24-20 // func Yremovexattr(tls *TLS, path uintptr, name uintptr) (r int32) TEXT ·Yremovexattr(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -11938,6 +13791,8 @@ TEXT ·Yremovexattr(SB),$32-28 // func Yremque(tls *TLS, element uintptr) TEXT ·Yremque(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ element+8(FP), AX @@ -11947,6 +13802,8 @@ TEXT ·Yremque(SB),$16-16 // func Yremquo(tls *TLS, x float64, y float64, quo uintptr) (r float64) TEXT ·Yremquo(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -11962,6 +13819,8 @@ TEXT ·Yremquo(SB),$40-40 // func Yremquof(tls *TLS, x float32, y float32, quo uintptr) (r float32) TEXT ·Yremquof(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -11977,6 +13836,8 @@ TEXT ·Yremquof(SB),$32-28 // func Yremquol(tls *TLS, x float64, y float64, quo uintptr) (r float64) TEXT ·Yremquol(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -11992,6 +13853,8 @@ TEXT ·Yremquol(SB),$40-40 // func Yrename(tls *TLS, old uintptr, new1 uintptr) (r int32) TEXT ·Yrename(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ old+8(FP), AX @@ -12005,6 +13868,8 @@ TEXT ·Yrename(SB),$32-28 // func Yrenameat(tls *TLS, oldfd int32, old uintptr, newfd int32, new1 uintptr) (r int32) TEXT ·Yrenameat(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL oldfd+8(FP), AX @@ -12022,6 +13887,8 @@ TEXT ·Yrenameat(SB),$48-44 // func Yrenameat2(t *TLS, olddirfd int32, oldpath uintptr, newdirfd int32, newpath uintptr, flags int32) int32 TEXT ·Yrenameat2(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVL olddirfd+8(FP), AX @@ -12041,6 +13908,8 @@ TEXT ·Yrenameat2(SB),$56-52 // func Yres_init(tls *TLS) (r int32) TEXT ·Yres_init(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xres_init(SB) @@ -12050,6 +13919,8 @@ TEXT ·Yres_init(SB),$16-12 // func Yres_mkquery(tls *TLS, op int32, dname uintptr, class int32, type1 int32, data uintptr, datalen int32, newrr uintptr, buf uintptr, buflen int32) (r int32) TEXT ·Yres_mkquery(SB),$80-76 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL op+8(FP), AX @@ -12077,6 +13948,8 @@ TEXT ·Yres_mkquery(SB),$80-76 // func Yres_send(tls *TLS, _msg uintptr, _msglen int32, _answer uintptr, _anslen int32) (r int32) TEXT ·Yres_send(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ _msg+8(FP), AX @@ -12094,6 +13967,8 @@ TEXT ·Yres_send(SB),$48-44 // func Yrewind(tls *TLS, f uintptr) TEXT ·Yrewind(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -12103,6 +13978,8 @@ TEXT ·Yrewind(SB),$16-16 // func Yrewinddir(tls *TLS, dir uintptr) TEXT ·Yrewinddir(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -12112,6 +13989,8 @@ TEXT ·Yrewinddir(SB),$16-16 // func Yrindex(tls *TLS, s uintptr, c int32) (r uintptr) TEXT ·Yrindex(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -12125,6 +14004,8 @@ TEXT ·Yrindex(SB),$32-32 // func Yrint(tls *TLS, x float64) (r float64) TEXT ·Yrint(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12136,6 +14017,8 @@ TEXT ·Yrint(SB),$24-24 // func Yrintf(tls *TLS, x float32) (r float32) TEXT ·Yrintf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -12147,6 +14030,8 @@ TEXT ·Yrintf(SB),$24-20 // func Yrintl(tls *TLS, x float64) (r float64) TEXT ·Yrintl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12158,6 +14043,8 @@ TEXT ·Yrintl(SB),$24-24 // func Yrmdir(tls *TLS, path uintptr) (r int32) TEXT ·Yrmdir(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -12169,6 +14056,8 @@ TEXT ·Yrmdir(SB),$24-20 // func Yround(tls *TLS, x3 float64) (r float64) TEXT ·Yround(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -12180,6 +14069,8 @@ TEXT ·Yround(SB),$24-24 // func Yroundf(tls *TLS, x3 float32) (r float32) TEXT ·Yroundf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -12191,6 +14082,8 @@ TEXT ·Yroundf(SB),$24-20 // func Yroundl(tls *TLS, x float64) (r float64) TEXT ·Yroundl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12202,6 +14095,8 @@ TEXT ·Yroundl(SB),$24-24 // func Ysbrk(tls *TLS, inc Tintptr_t) (r uintptr) TEXT ·Ysbrk(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ inc+8(FP), AX @@ -12213,6 +14108,8 @@ TEXT ·Ysbrk(SB),$24-24 // func Yscalb(tls *TLS, x float64, fn float64) (r float64) TEXT ·Yscalb(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12226,6 +14123,8 @@ TEXT ·Yscalb(SB),$32-32 // func Yscalbf(tls *TLS, x float32, fn float32) (r float32) TEXT ·Yscalbf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -12239,6 +14138,8 @@ TEXT ·Yscalbf(SB),$24-20 // func Yscalbln(tls *TLS, x float64, n int64) (r float64) TEXT ·Yscalbln(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12252,6 +14153,8 @@ TEXT ·Yscalbln(SB),$32-32 // func Yscalblnf(tls *TLS, x float32, n int64) (r float32) TEXT ·Yscalblnf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -12265,6 +14168,8 @@ TEXT ·Yscalblnf(SB),$32-28 // func Yscalblnl(tls *TLS, x float64, n int64) (r float64) TEXT ·Yscalblnl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12278,6 +14183,8 @@ TEXT ·Yscalblnl(SB),$32-32 // func Yscalbn(tls *TLS, x float64, n int32) (r float64) TEXT ·Yscalbn(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12291,6 +14198,8 @@ TEXT ·Yscalbn(SB),$32-32 // func Yscalbnf(tls *TLS, x float32, n int32) (r float32) TEXT ·Yscalbnf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -12304,6 +14213,8 @@ TEXT ·Yscalbnf(SB),$24-20 // func Yscalbnl(tls *TLS, x float64, n int32) (r float64) TEXT ·Yscalbnl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -12317,6 +14228,8 @@ TEXT ·Yscalbnl(SB),$32-32 // func Yscandir(tls *TLS, path uintptr, res uintptr, sel uintptr, cmp uintptr) (r int32) TEXT ·Yscandir(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -12334,6 +14247,8 @@ TEXT ·Yscandir(SB),$48-44 // func Yscanf(tls *TLS, fmt uintptr, va uintptr) (r int32) TEXT ·Yscanf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -12347,6 +14262,8 @@ TEXT ·Yscanf(SB),$32-28 // func Ysched_yield(tls *TLS) int32 TEXT ·Ysched_yield(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsched_yield(SB) @@ -12356,6 +14273,8 @@ TEXT ·Ysched_yield(SB),$16-12 // func Ysecure_getenv(tls *TLS, name uintptr) (r uintptr) TEXT ·Ysecure_getenv(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -12367,6 +14286,8 @@ TEXT ·Ysecure_getenv(SB),$24-24 // func Yseed48(tls *TLS, s uintptr) (r uintptr) TEXT ·Yseed48(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -12378,6 +14299,8 @@ TEXT ·Yseed48(SB),$24-24 // func Yseekdir(tls *TLS, dir uintptr, off int64) TEXT ·Yseekdir(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -12389,6 +14312,8 @@ TEXT ·Yseekdir(SB),$24-24 // func Yselect(tls *TLS, n int32, rfds uintptr, wfds uintptr, efds uintptr, tv uintptr) (r int32) TEXT ·Yselect(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -12408,6 +14333,8 @@ TEXT ·Yselect(SB),$56-52 // func Ysemctl(tls *TLS, id int32, num int32, cmd int32, va uintptr) (r1 int32) TEXT ·Ysemctl(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL id+8(FP), AX @@ -12425,6 +14352,8 @@ TEXT ·Ysemctl(SB),$40-36 // func Ysemget(tls *TLS, key Tkey_t, n int32, fl int32) (r int32) TEXT ·Ysemget(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL key+8(FP), AX @@ -12440,6 +14369,8 @@ TEXT ·Ysemget(SB),$32-28 // func Ysemop(tls *TLS, id int32, buf uintptr, n Tsize_t) (r int32) TEXT ·Ysemop(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL id+8(FP), AX @@ -12455,6 +14386,8 @@ TEXT ·Ysemop(SB),$40-36 // func Ysemtimedop(tls *TLS, id int32, buf uintptr, n Tsize_t, ts uintptr) (r int32) TEXT ·Ysemtimedop(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL id+8(FP), AX @@ -12472,6 +14405,8 @@ TEXT ·Ysemtimedop(SB),$48-44 // func Ysend(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32) (r Tssize_t) TEXT ·Ysend(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -12489,6 +14424,8 @@ TEXT ·Ysend(SB),$48-48 // func Ysendfile(tls *TLS, out_fd int32, in_fd int32, ofs uintptr, count Tsize_t) (r Tssize_t) TEXT ·Ysendfile(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL out_fd+8(FP), AX @@ -12506,6 +14443,8 @@ TEXT ·Ysendfile(SB),$40-40 // func Ysendmmsg(tls *TLS, fd int32, msgvec uintptr, vlen uint32, flags uint32) (r1 int32) TEXT ·Ysendmmsg(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -12523,6 +14462,8 @@ TEXT ·Ysendmmsg(SB),$40-36 // func Ysendmsg(tls *TLS, fd int32, msg uintptr, flags int32) (r1 Tssize_t) TEXT ·Ysendmsg(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -12538,6 +14479,8 @@ TEXT ·Ysendmsg(SB),$40-40 // func Ysendto(tls *TLS, fd int32, buf uintptr, len1 Tsize_t, flags int32, addr uintptr, alen Tsocklen_t) (r1 Tssize_t) TEXT ·Ysendto(SB),$64-64 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -12559,6 +14502,8 @@ TEXT ·Ysendto(SB),$64-64 // func Ysetbuf(tls *TLS, f uintptr, buf uintptr) TEXT ·Ysetbuf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -12570,6 +14515,8 @@ TEXT ·Ysetbuf(SB),$24-24 // func Ysetbuffer(tls *TLS, f uintptr, buf uintptr, size Tsize_t) TEXT ·Ysetbuffer(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -12583,6 +14530,8 @@ TEXT ·Ysetbuffer(SB),$32-32 // func Ysetdomainname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) TEXT ·Ysetdomainname(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -12596,6 +14545,8 @@ TEXT ·Ysetdomainname(SB),$32-28 // func Ysetenv(tls *TLS, var1 uintptr, value uintptr, overwrite int32) (r int32) TEXT ·Ysetenv(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ var1+8(FP), AX @@ -12611,6 +14562,8 @@ TEXT ·Ysetenv(SB),$40-36 // func Ysetfsgid(tls *TLS, gid Tgid_t) (r int32) TEXT ·Ysetfsgid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL gid+8(FP), AX @@ -12622,6 +14575,8 @@ TEXT ·Ysetfsgid(SB),$24-20 // func Ysetfsuid(tls *TLS, uid Tuid_t) (r int32) TEXT ·Ysetfsuid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL uid+8(FP), AX @@ -12633,6 +14588,8 @@ TEXT ·Ysetfsuid(SB),$24-20 // func Ysetgid(tls *TLS, gid Tgid_t) (r int32) TEXT ·Ysetgid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL gid+8(FP), AX @@ -12644,6 +14601,8 @@ TEXT ·Ysetgid(SB),$24-20 // func Ysetgrent(tls *TLS) TEXT ·Ysetgrent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetgrent(SB) @@ -12651,6 +14610,8 @@ TEXT ·Ysetgrent(SB),$8-8 // func Ysethostent(tls *TLS, x int32) TEXT ·Ysethostent(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -12660,6 +14621,8 @@ TEXT ·Ysethostent(SB),$16-12 // func Ysethostname(tls *TLS, name uintptr, len1 Tsize_t) (r int32) TEXT ·Ysethostname(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -12673,6 +14636,8 @@ TEXT ·Ysethostname(SB),$32-28 // func Ysetitimer(tls *TLS, which int32, new1 uintptr, old uintptr) (r1 int32) TEXT ·Ysetitimer(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL which+8(FP), AX @@ -12688,6 +14653,8 @@ TEXT ·Ysetitimer(SB),$40-36 // func Ysetjmp(t *TLS, env uintptr) int32 TEXT ·Ysetjmp(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ env+8(FP), AX @@ -12699,6 +14666,8 @@ TEXT ·Ysetjmp(SB),$24-20 // func Ysetkey(tls *TLS, key uintptr) TEXT ·Ysetkey(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -12708,6 +14677,8 @@ TEXT ·Ysetkey(SB),$16-16 // func Ysetlinebuf(tls *TLS, f uintptr) TEXT ·Ysetlinebuf(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -12717,6 +14688,8 @@ TEXT ·Ysetlinebuf(SB),$16-16 // func Ysetlocale(tls *TLS, cat int32, name uintptr) (r uintptr) TEXT ·Ysetlocale(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL cat+8(FP), AX @@ -12730,6 +14703,8 @@ TEXT ·Ysetlocale(SB),$32-32 // func Ysetlogmask(tls *TLS, maskpri int32) (r int32) TEXT ·Ysetlogmask(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL maskpri+8(FP), AX @@ -12741,6 +14716,8 @@ TEXT ·Ysetlogmask(SB),$24-20 // func Ysetmntent(tls *TLS, name uintptr, mode uintptr) (r uintptr) TEXT ·Ysetmntent(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -12754,6 +14731,8 @@ TEXT ·Ysetmntent(SB),$32-32 // func Ysetnetent(tls *TLS, x int32) TEXT ·Ysetnetent(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -12763,6 +14742,8 @@ TEXT ·Ysetnetent(SB),$16-12 // func Ysetns(tls *TLS, fd int32, nstype int32) (r int32) TEXT ·Ysetns(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -12776,6 +14757,8 @@ TEXT ·Ysetns(SB),$24-20 // func Ysetpgid(tls *TLS, pid Tpid_t, pgid Tpid_t) (r int32) TEXT ·Ysetpgid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -12789,6 +14772,8 @@ TEXT ·Ysetpgid(SB),$24-20 // func Ysetpgrp(tls *TLS) (r Tpid_t) TEXT ·Ysetpgrp(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetpgrp(SB) @@ -12798,6 +14783,8 @@ TEXT ·Ysetpgrp(SB),$16-12 // func Ysetpriority(tls *TLS, which int32, who Tid_t, prio int32) (r int32) TEXT ·Ysetpriority(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL which+8(FP), AX @@ -12813,6 +14800,8 @@ TEXT ·Ysetpriority(SB),$32-28 // func Ysetprotoent(tls *TLS, stayopen int32) TEXT ·Ysetprotoent(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL stayopen+8(FP), AX @@ -12822,6 +14811,8 @@ TEXT ·Ysetprotoent(SB),$16-12 // func Ysetpwent(tls *TLS) TEXT ·Ysetpwent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetpwent(SB) @@ -12829,6 +14820,8 @@ TEXT ·Ysetpwent(SB),$8-8 // func Ysetrlimit(tls *TLS, resource int32, rlim uintptr) (r int32) TEXT ·Ysetrlimit(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL resource+8(FP), AX @@ -12842,6 +14835,8 @@ TEXT ·Ysetrlimit(SB),$32-28 // func Ysetrlimit64(tls *TLS, resource int32, rlim uintptr) (r int32) TEXT ·Ysetrlimit64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL resource+8(FP), AX @@ -12855,6 +14850,8 @@ TEXT ·Ysetrlimit64(SB),$32-28 // func Ysetservent(tls *TLS, stayopen int32) TEXT ·Ysetservent(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL stayopen+8(FP), AX @@ -12864,6 +14861,8 @@ TEXT ·Ysetservent(SB),$16-12 // func Ysetsid(tls *TLS) (r Tpid_t) TEXT ·Ysetsid(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetsid(SB) @@ -12873,6 +14872,8 @@ TEXT ·Ysetsid(SB),$16-12 // func Ysetsockopt(tls *TLS, fd int32, level int32, optname int32, optval uintptr, optlen Tsocklen_t) (r2 int32) TEXT ·Ysetsockopt(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -12892,6 +14893,8 @@ TEXT ·Ysetsockopt(SB),$48-44 // func Ysetspent(tls *TLS) TEXT ·Ysetspent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetspent(SB) @@ -12899,6 +14902,8 @@ TEXT ·Ysetspent(SB),$8-8 // func Ysetstate(tls *TLS, state uintptr) (r uintptr) TEXT ·Ysetstate(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ state+8(FP), AX @@ -12910,6 +14915,8 @@ TEXT ·Ysetstate(SB),$24-24 // func Ysettimeofday(tls *TLS, tv uintptr, tz uintptr) (r int32) TEXT ·Ysettimeofday(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tv+8(FP), AX @@ -12923,6 +14930,8 @@ TEXT ·Ysettimeofday(SB),$32-28 // func Ysetuid(tls *TLS, uid Tuid_t) (r int32) TEXT ·Ysetuid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL uid+8(FP), AX @@ -12934,6 +14943,8 @@ TEXT ·Ysetuid(SB),$24-20 // func Ysetusershell(tls *TLS) TEXT ·Ysetusershell(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetusershell(SB) @@ -12941,6 +14952,8 @@ TEXT ·Ysetusershell(SB),$8-8 // func Ysetutent(tls *TLS) TEXT ·Ysetutent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetutent(SB) @@ -12948,6 +14961,8 @@ TEXT ·Ysetutent(SB),$8-8 // func Ysetutxent(tls *TLS) TEXT ·Ysetutxent(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsetutxent(SB) @@ -12955,6 +14970,8 @@ TEXT ·Ysetutxent(SB),$8-8 // func Ysetvbuf(tls *TLS, f uintptr, buf uintptr, type1 int32, size Tsize_t) (r int32) TEXT ·Ysetvbuf(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -12972,6 +14989,8 @@ TEXT ·Ysetvbuf(SB),$48-44 // func Ysetxattr(tls *TLS, path uintptr, name uintptr, value uintptr, size Tsize_t, flags int32) (r int32) TEXT ·Ysetxattr(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -12991,6 +15010,8 @@ TEXT ·Ysetxattr(SB),$56-52 // func Yshm_open(tls *TLS, name uintptr, flag int32, mode Tmode_t) (r int32) TEXT ·Yshm_open(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -13006,6 +15027,8 @@ TEXT ·Yshm_open(SB),$32-28 // func Yshm_unlink(tls *TLS, name uintptr) (r int32) TEXT ·Yshm_unlink(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -13017,6 +15040,8 @@ TEXT ·Yshm_unlink(SB),$24-20 // func Yshmat(tls *TLS, id int32, addr uintptr, flag int32) (r uintptr) TEXT ·Yshmat(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL id+8(FP), AX @@ -13032,6 +15057,8 @@ TEXT ·Yshmat(SB),$40-40 // func Yshmctl(tls *TLS, id int32, cmd int32, buf uintptr) (r1 int32) TEXT ·Yshmctl(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL id+8(FP), AX @@ -13047,6 +15074,8 @@ TEXT ·Yshmctl(SB),$32-28 // func Yshmdt(tls *TLS, addr uintptr) (r int32) TEXT ·Yshmdt(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ addr+8(FP), AX @@ -13058,6 +15087,8 @@ TEXT ·Yshmdt(SB),$24-20 // func Yshmget(tls *TLS, key Tkey_t, size Tsize_t, flag int32) (r int32) TEXT ·Yshmget(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL key+8(FP), AX @@ -13073,6 +15104,8 @@ TEXT ·Yshmget(SB),$40-36 // func Yshutdown(tls *TLS, fd int32, how int32) (r1 int32) TEXT ·Yshutdown(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -13086,6 +15119,8 @@ TEXT ·Yshutdown(SB),$24-20 // func Ysigaction(tls *TLS, sig int32, sa uintptr, old uintptr) (r int32) TEXT ·Ysigaction(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL sig+8(FP), AX @@ -13101,6 +15136,8 @@ TEXT ·Ysigaction(SB),$40-36 // func Ysigaddset(tls *TLS, set uintptr, sig int32) (r int32) TEXT ·Ysigaddset(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ set+8(FP), AX @@ -13114,6 +15151,8 @@ TEXT ·Ysigaddset(SB),$32-28 // func Ysigaltstack(tls *TLS, ss uintptr, old uintptr) (r int32) TEXT ·Ysigaltstack(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ss+8(FP), AX @@ -13127,6 +15166,8 @@ TEXT ·Ysigaltstack(SB),$32-28 // func Ysigandset(tls *TLS, dest uintptr, left uintptr, right uintptr) (r1 int32) TEXT ·Ysigandset(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -13142,6 +15183,8 @@ TEXT ·Ysigandset(SB),$40-36 // func Ysigdelset(tls *TLS, set uintptr, sig int32) (r int32) TEXT ·Ysigdelset(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ set+8(FP), AX @@ -13155,6 +15198,8 @@ TEXT ·Ysigdelset(SB),$32-28 // func Ysigemptyset(tls *TLS, set uintptr) (r int32) TEXT ·Ysigemptyset(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ set+8(FP), AX @@ -13166,6 +15211,8 @@ TEXT ·Ysigemptyset(SB),$24-20 // func Ysigfillset(tls *TLS, set uintptr) (r int32) TEXT ·Ysigfillset(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ set+8(FP), AX @@ -13177,6 +15224,8 @@ TEXT ·Ysigfillset(SB),$24-20 // func Ysigisemptyset(tls *TLS, set uintptr) (r int32) TEXT ·Ysigisemptyset(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ set+8(FP), AX @@ -13188,6 +15237,8 @@ TEXT ·Ysigisemptyset(SB),$24-20 // func Ysigismember(tls *TLS, set uintptr, sig int32) (r int32) TEXT ·Ysigismember(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ set+8(FP), AX @@ -13201,6 +15252,8 @@ TEXT ·Ysigismember(SB),$32-28 // func Ysignal(tls *TLS, signum int32, handler uintptr) (r uintptr) TEXT ·Ysignal(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL signum+8(FP), AX @@ -13214,6 +15267,8 @@ TEXT ·Ysignal(SB),$32-32 // func Ysignalfd(tls *TLS, fd int32, sigs uintptr, flags int32) (r int32) TEXT ·Ysignalfd(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -13229,6 +15284,8 @@ TEXT ·Ysignalfd(SB),$40-36 // func Ysignificand(tls *TLS, x float64) (r float64) TEXT ·Ysignificand(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -13240,6 +15297,8 @@ TEXT ·Ysignificand(SB),$24-24 // func Ysignificandf(tls *TLS, x float32) (r float32) TEXT ·Ysignificandf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -13251,6 +15310,8 @@ TEXT ·Ysignificandf(SB),$24-20 // func Ysigorset(tls *TLS, dest uintptr, left uintptr, right uintptr) (r1 int32) TEXT ·Ysigorset(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -13266,6 +15327,8 @@ TEXT ·Ysigorset(SB),$40-36 // func Ysigpending(tls *TLS, set uintptr) (r int32) TEXT ·Ysigpending(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ set+8(FP), AX @@ -13277,6 +15340,8 @@ TEXT ·Ysigpending(SB),$24-20 // func Ysigprocmask(tls *TLS, how int32, set uintptr, old uintptr) (r1 int32) TEXT ·Ysigprocmask(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL how+8(FP), AX @@ -13292,6 +15357,8 @@ TEXT ·Ysigprocmask(SB),$40-36 // func Ysigqueue(tls *TLS, pid Tpid_t, sig int32, value Tsigval) (r1 int32) TEXT ·Ysigqueue(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -13315,6 +15382,8 @@ TEXT ·Ysigqueue(SB),$32-28 // func Ysigsuspend(tls *TLS, mask uintptr) (r int32) TEXT ·Ysigsuspend(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ mask+8(FP), AX @@ -13326,6 +15395,8 @@ TEXT ·Ysigsuspend(SB),$24-20 // func Ysigtimedwait(tls *TLS, mask uintptr, si uintptr, timeout uintptr) (r int32) TEXT ·Ysigtimedwait(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ mask+8(FP), AX @@ -13341,6 +15412,8 @@ TEXT ·Ysigtimedwait(SB),$40-36 // func Ysigwait(tls *TLS, mask uintptr, sig uintptr) (r int32) TEXT ·Ysigwait(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ mask+8(FP), AX @@ -13354,6 +15427,8 @@ TEXT ·Ysigwait(SB),$32-28 // func Ysigwaitinfo(tls *TLS, mask uintptr, si uintptr) (r int32) TEXT ·Ysigwaitinfo(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ mask+8(FP), AX @@ -13367,6 +15442,8 @@ TEXT ·Ysigwaitinfo(SB),$32-28 // func Ysin(tls *TLS, x3 float64) (r float64) TEXT ·Ysin(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -13378,6 +15455,8 @@ TEXT ·Ysin(SB),$24-24 // func Ysincos(tls *TLS, x3 float64, sin uintptr, cos uintptr) TEXT ·Ysincos(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -13391,6 +15470,8 @@ TEXT ·Ysincos(SB),$32-32 // func Ysincosf(tls *TLS, x3 float32, sin uintptr, cos uintptr) TEXT ·Ysincosf(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -13404,6 +15485,8 @@ TEXT ·Ysincosf(SB),$32-32 // func Ysincosl(tls *TLS, x float64, sin uintptr, cos uintptr) TEXT ·Ysincosl(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -13417,6 +15500,8 @@ TEXT ·Ysincosl(SB),$32-32 // func Ysinf(tls *TLS, x3 float32) (r float32) TEXT ·Ysinf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -13428,6 +15513,8 @@ TEXT ·Ysinf(SB),$24-20 // func Ysinh(tls *TLS, x float64) (r float64) TEXT ·Ysinh(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -13439,6 +15526,8 @@ TEXT ·Ysinh(SB),$24-24 // func Ysinhf(tls *TLS, x float32) (r float32) TEXT ·Ysinhf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -13450,6 +15539,8 @@ TEXT ·Ysinhf(SB),$24-20 // func Ysinhl(tls *TLS, x float64) (r float64) TEXT ·Ysinhl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -13461,6 +15552,8 @@ TEXT ·Ysinhl(SB),$24-24 // func Ysinl(tls *TLS, x float64) (r float64) TEXT ·Ysinl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -13472,6 +15565,8 @@ TEXT ·Ysinl(SB),$24-24 // func Ysleep(tls *TLS, seconds uint32) (r uint32) TEXT ·Ysleep(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL seconds+8(FP), AX @@ -13483,6 +15578,8 @@ TEXT ·Ysleep(SB),$24-20 // func Ysnprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, va uintptr) (r int32) TEXT ·Ysnprintf(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13500,6 +15597,8 @@ TEXT ·Ysnprintf(SB),$48-44 // func Ysockatmark(tls *TLS, s int32) (r int32) TEXT ·Ysockatmark(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL s+8(FP), AX @@ -13511,6 +15610,8 @@ TEXT ·Ysockatmark(SB),$24-20 // func Ysocket(tls *TLS, domain int32, type1 int32, protocol int32) (r1 int32) TEXT ·Ysocket(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL domain+8(FP), AX @@ -13526,6 +15627,8 @@ TEXT ·Ysocket(SB),$32-28 // func Ysocketpair(tls *TLS, domain int32, type1 int32, protocol int32, fd uintptr) (r2 int32) TEXT ·Ysocketpair(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL domain+8(FP), AX @@ -13543,6 +15646,8 @@ TEXT ·Ysocketpair(SB),$40-36 // func Ysplice(tls *TLS, fd_in int32, off_in uintptr, fd_out int32, off_out uintptr, len1 Tsize_t, flags uint32) (r Tssize_t) TEXT ·Ysplice(SB),$64-64 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd_in+8(FP), AX @@ -13564,6 +15669,8 @@ TEXT ·Ysplice(SB),$64-64 // func Ysprintf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Ysprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13579,6 +15686,8 @@ TEXT ·Ysprintf(SB),$40-36 // func Ysqrt(tls *TLS, x1 float64) (r1 float64) TEXT ·Ysqrt(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x1+8(FP), AX @@ -13590,6 +15699,8 @@ TEXT ·Ysqrt(SB),$24-24 // func Ysqrtf(tls *TLS, x1 float32) (r1 float32) TEXT ·Ysqrtf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x1+8(FP), AX @@ -13601,6 +15712,8 @@ TEXT ·Ysqrtf(SB),$24-20 // func Ysqrtl(tls *TLS, x float64) (r float64) TEXT ·Ysqrtl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -13612,6 +15725,8 @@ TEXT ·Ysqrtl(SB),$24-24 // func Ysrand(tls *TLS, s uint32) TEXT ·Ysrand(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL s+8(FP), AX @@ -13621,6 +15736,8 @@ TEXT ·Ysrand(SB),$16-12 // func Ysrand48(tls *TLS, seed int64) TEXT ·Ysrand48(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ seed+8(FP), AX @@ -13630,6 +15747,8 @@ TEXT ·Ysrand48(SB),$16-16 // func Ysrandom(tls *TLS, seed uint32) TEXT ·Ysrandom(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL seed+8(FP), AX @@ -13639,6 +15758,8 @@ TEXT ·Ysrandom(SB),$16-12 // func Ysscanf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Ysscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13654,6 +15775,8 @@ TEXT ·Ysscanf(SB),$40-36 // func Ystat(tls *TLS, path uintptr, buf uintptr) (r int32) TEXT ·Ystat(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -13667,6 +15790,8 @@ TEXT ·Ystat(SB),$32-28 // func Ystat64(tls *TLS, path uintptr, buf uintptr) (r int32) TEXT ·Ystat64(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -13680,6 +15805,8 @@ TEXT ·Ystat64(SB),$32-28 // func Ystatvfs(tls *TLS, path uintptr, buf uintptr) (r int32) TEXT ·Ystatvfs(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -13693,6 +15820,8 @@ TEXT ·Ystatvfs(SB),$32-28 // func Ystatx(tls *TLS, dirfd int32, path uintptr, flags int32, mask uint32, stx uintptr) (r int32) TEXT ·Ystatx(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL dirfd+8(FP), AX @@ -13712,6 +15841,8 @@ TEXT ·Ystatx(SB),$48-44 // func Ystime(tls *TLS, t uintptr) (r int32) TEXT ·Ystime(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -13723,6 +15854,8 @@ TEXT ·Ystime(SB),$24-20 // func Ystpcpy(tls *TLS, d uintptr, s uintptr) (r uintptr) TEXT ·Ystpcpy(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -13736,6 +15869,8 @@ TEXT ·Ystpcpy(SB),$32-32 // func Ystpncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ystpncpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -13751,6 +15886,8 @@ TEXT ·Ystpncpy(SB),$40-40 // func Ystrcasecmp(tls *TLS, _l uintptr, _r uintptr) (r1 int32) TEXT ·Ystrcasecmp(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ _l+8(FP), AX @@ -13764,6 +15901,8 @@ TEXT ·Ystrcasecmp(SB),$32-28 // func Ystrcasecmp_l(tls *TLS, l uintptr, r uintptr, loc Tlocale_t) (r1 int32) TEXT ·Ystrcasecmp_l(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -13779,6 +15918,8 @@ TEXT ·Ystrcasecmp_l(SB),$40-36 // func Ystrcasestr(tls *TLS, h uintptr, n uintptr) (r uintptr) TEXT ·Ystrcasestr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ h+8(FP), AX @@ -13792,6 +15933,8 @@ TEXT ·Ystrcasestr(SB),$32-32 // func Ystrcat(tls *TLS, dest uintptr, src uintptr) (r uintptr) TEXT ·Ystrcat(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -13805,6 +15948,8 @@ TEXT ·Ystrcat(SB),$32-32 // func Ystrchr(tls *TLS, s uintptr, c int32) (r1 uintptr) TEXT ·Ystrchr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13818,6 +15963,8 @@ TEXT ·Ystrchr(SB),$32-32 // func Ystrchrnul(tls *TLS, s uintptr, c int32) (r uintptr) TEXT ·Ystrchrnul(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13831,6 +15978,8 @@ TEXT ·Ystrchrnul(SB),$32-32 // func Ystrcmp(tls *TLS, l uintptr, r uintptr) (r1 int32) TEXT ·Ystrcmp(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -13844,6 +15993,8 @@ TEXT ·Ystrcmp(SB),$32-28 // func Ystrcoll(tls *TLS, l uintptr, r uintptr) (r1 int32) TEXT ·Ystrcoll(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -13857,6 +16008,8 @@ TEXT ·Ystrcoll(SB),$32-28 // func Ystrcoll_l(tls *TLS, l uintptr, r uintptr, loc Tlocale_t) (r1 int32) TEXT ·Ystrcoll_l(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -13872,6 +16025,8 @@ TEXT ·Ystrcoll_l(SB),$40-36 // func Ystrcpy(tls *TLS, dest uintptr, src uintptr) (r uintptr) TEXT ·Ystrcpy(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -13885,6 +16040,8 @@ TEXT ·Ystrcpy(SB),$32-32 // func Ystrcspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) TEXT ·Ystrcspn(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13898,6 +16055,8 @@ TEXT ·Ystrcspn(SB),$32-32 // func Ystrdup(tls *TLS, s uintptr) (r uintptr) TEXT ·Ystrdup(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13909,6 +16068,8 @@ TEXT ·Ystrdup(SB),$24-24 // func Ystrerror(tls *TLS, e int32) (r uintptr) TEXT ·Ystrerror(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL e+8(FP), AX @@ -13920,6 +16081,8 @@ TEXT ·Ystrerror(SB),$24-24 // func Ystrerror_l(tls *TLS, e int32, loc Tlocale_t) (r uintptr) TEXT ·Ystrerror_l(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL e+8(FP), AX @@ -13933,6 +16096,8 @@ TEXT ·Ystrerror_l(SB),$32-32 // func Ystrerror_r(tls *TLS, err int32, buf uintptr, buflen Tsize_t) (r int32) TEXT ·Ystrerror_r(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL err+8(FP), AX @@ -13948,6 +16113,8 @@ TEXT ·Ystrerror_r(SB),$40-36 // func Ystrfmon(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, va uintptr) (r Tssize_t) TEXT ·Ystrfmon(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13965,6 +16132,8 @@ TEXT ·Ystrfmon(SB),$48-48 // func Ystrfmon_l(tls *TLS, s uintptr, n Tsize_t, loc Tlocale_t, fmt uintptr, va uintptr) (r Tssize_t) TEXT ·Ystrfmon_l(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -13984,6 +16153,8 @@ TEXT ·Ystrfmon_l(SB),$56-56 // func Ystrftime(tls *TLS, s uintptr, n Tsize_t, f uintptr, tm uintptr) (r Tsize_t) TEXT ·Ystrftime(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14001,6 +16172,8 @@ TEXT ·Ystrftime(SB),$48-48 // func Ystrftime_l(tls *TLS, s uintptr, n Tsize_t, f uintptr, tm uintptr, loc Tlocale_t) (r Tsize_t) TEXT ·Ystrftime_l(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14020,6 +16193,8 @@ TEXT ·Ystrftime_l(SB),$56-56 // func Ystrlcat(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r Tsize_t) TEXT ·Ystrlcat(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -14035,6 +16210,8 @@ TEXT ·Ystrlcat(SB),$40-40 // func Ystrlcpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r Tsize_t) TEXT ·Ystrlcpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -14050,6 +16227,8 @@ TEXT ·Ystrlcpy(SB),$40-40 // func Ystrlen(tls *TLS, s uintptr) (r Tsize_t) TEXT ·Ystrlen(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14061,6 +16240,8 @@ TEXT ·Ystrlen(SB),$24-24 // func Ystrncasecmp(tls *TLS, _l uintptr, _r uintptr, n Tsize_t) (r1 int32) TEXT ·Ystrncasecmp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ _l+8(FP), AX @@ -14076,6 +16257,8 @@ TEXT ·Ystrncasecmp(SB),$40-36 // func Ystrncasecmp_l(tls *TLS, l uintptr, r uintptr, n Tsize_t, loc Tlocale_t) (r1 int32) TEXT ·Ystrncasecmp_l(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -14093,6 +16276,8 @@ TEXT ·Ystrncasecmp_l(SB),$48-44 // func Ystrncat(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ystrncat(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -14108,6 +16293,8 @@ TEXT ·Ystrncat(SB),$40-40 // func Ystrncmp(tls *TLS, _l uintptr, _r uintptr, n Tsize_t) (r1 int32) TEXT ·Ystrncmp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ _l+8(FP), AX @@ -14123,6 +16310,8 @@ TEXT ·Ystrncmp(SB),$40-36 // func Ystrncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ystrncpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -14138,6 +16327,8 @@ TEXT ·Ystrncpy(SB),$40-40 // func Ystrndup(tls *TLS, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ystrndup(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14151,6 +16342,8 @@ TEXT ·Ystrndup(SB),$32-32 // func Ystrnlen(tls *TLS, s uintptr, n Tsize_t) (r Tsize_t) TEXT ·Ystrnlen(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14164,6 +16357,8 @@ TEXT ·Ystrnlen(SB),$32-32 // func Ystrpbrk(tls *TLS, s uintptr, b uintptr) (r uintptr) TEXT ·Ystrpbrk(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14177,6 +16372,8 @@ TEXT ·Ystrpbrk(SB),$32-32 // func Ystrptime(tls *TLS, s uintptr, f uintptr, tm uintptr) (r uintptr) TEXT ·Ystrptime(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14192,6 +16389,8 @@ TEXT ·Ystrptime(SB),$40-40 // func Ystrrchr(tls *TLS, s uintptr, c int32) (r uintptr) TEXT ·Ystrrchr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14205,6 +16404,8 @@ TEXT ·Ystrrchr(SB),$32-32 // func Ystrsep(tls *TLS, str uintptr, sep uintptr) (r uintptr) TEXT ·Ystrsep(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ str+8(FP), AX @@ -14218,6 +16419,8 @@ TEXT ·Ystrsep(SB),$32-32 // func Ystrsignal(tls *TLS, signum int32) (r uintptr) TEXT ·Ystrsignal(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL signum+8(FP), AX @@ -14229,6 +16432,8 @@ TEXT ·Ystrsignal(SB),$24-24 // func Ystrspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) TEXT ·Ystrspn(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14242,6 +16447,8 @@ TEXT ·Ystrspn(SB),$32-32 // func Ystrstr(tls *TLS, h uintptr, n uintptr) (r uintptr) TEXT ·Ystrstr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ h+8(FP), AX @@ -14255,6 +16462,8 @@ TEXT ·Ystrstr(SB),$32-32 // func Ystrtod(tls *TLS, s uintptr, p uintptr) (r float64) TEXT ·Ystrtod(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14268,6 +16477,8 @@ TEXT ·Ystrtod(SB),$32-32 // func Ystrtod_l(tls *TLS, s uintptr, p uintptr, l Tlocale_t) (r float64) TEXT ·Ystrtod_l(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14283,6 +16494,8 @@ TEXT ·Ystrtod_l(SB),$40-40 // func Ystrtof(tls *TLS, s uintptr, p uintptr) (r float32) TEXT ·Ystrtof(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14296,6 +16509,8 @@ TEXT ·Ystrtof(SB),$32-28 // func Ystrtof_l(tls *TLS, s uintptr, p uintptr, l Tlocale_t) (r float32) TEXT ·Ystrtof_l(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14311,6 +16526,8 @@ TEXT ·Ystrtof_l(SB),$40-36 // func Ystrtoimax(tls *TLS, s uintptr, p uintptr, base int32) (r Tintmax_t) TEXT ·Ystrtoimax(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14326,6 +16543,8 @@ TEXT ·Ystrtoimax(SB),$40-40 // func Ystrtok(tls *TLS, s uintptr, sep uintptr) (r uintptr) TEXT ·Ystrtok(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14339,6 +16558,8 @@ TEXT ·Ystrtok(SB),$32-32 // func Ystrtok_r(tls *TLS, s uintptr, sep uintptr, p uintptr) (r uintptr) TEXT ·Ystrtok_r(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14354,6 +16575,8 @@ TEXT ·Ystrtok_r(SB),$40-40 // func Ystrtol(tls *TLS, s uintptr, p uintptr, base int32) (r int64) TEXT ·Ystrtol(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14369,6 +16592,8 @@ TEXT ·Ystrtol(SB),$40-40 // func Ystrtold(tls *TLS, s uintptr, p uintptr) (r float64) TEXT ·Ystrtold(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14382,6 +16607,8 @@ TEXT ·Ystrtold(SB),$32-32 // func Ystrtold_l(tls *TLS, s uintptr, p uintptr, l Tlocale_t) (r float64) TEXT ·Ystrtold_l(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14397,6 +16624,8 @@ TEXT ·Ystrtold_l(SB),$40-40 // func Ystrtoll(tls *TLS, s uintptr, p uintptr, base int32) (r int64) TEXT ·Ystrtoll(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14412,6 +16641,8 @@ TEXT ·Ystrtoll(SB),$40-40 // func Ystrtoul(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) TEXT ·Ystrtoul(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14427,6 +16658,8 @@ TEXT ·Ystrtoul(SB),$40-40 // func Ystrtoull(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) TEXT ·Ystrtoull(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14442,6 +16675,8 @@ TEXT ·Ystrtoull(SB),$40-40 // func Ystrtoumax(tls *TLS, s uintptr, p uintptr, base int32) (r Tuintmax_t) TEXT ·Ystrtoumax(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14457,6 +16692,8 @@ TEXT ·Ystrtoumax(SB),$40-40 // func Ystrverscmp(tls *TLS, l0 uintptr, r0 uintptr) (r1 int32) TEXT ·Ystrverscmp(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l0+8(FP), AX @@ -14470,6 +16707,8 @@ TEXT ·Ystrverscmp(SB),$32-28 // func Ystrxfrm(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r Tsize_t) TEXT ·Ystrxfrm(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -14485,6 +16724,8 @@ TEXT ·Ystrxfrm(SB),$40-40 // func Ystrxfrm_l(tls *TLS, dest uintptr, src uintptr, n Tsize_t, loc Tlocale_t) (r Tsize_t) TEXT ·Ystrxfrm_l(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -14502,6 +16743,8 @@ TEXT ·Ystrxfrm_l(SB),$48-48 // func Yswab(tls *TLS, _src uintptr, _dest uintptr, n Tssize_t) TEXT ·Yswab(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ _src+8(FP), AX @@ -14515,6 +16758,8 @@ TEXT ·Yswab(SB),$32-32 // func Yswapoff(tls *TLS, path uintptr) (r int32) TEXT ·Yswapoff(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -14526,6 +16771,8 @@ TEXT ·Yswapoff(SB),$24-20 // func Yswapon(tls *TLS, path uintptr, flags int32) (r int32) TEXT ·Yswapon(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -14539,6 +16786,8 @@ TEXT ·Yswapon(SB),$32-28 // func Yswprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, va uintptr) (r int32) TEXT ·Yswprintf(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14556,6 +16805,8 @@ TEXT ·Yswprintf(SB),$48-44 // func Yswscanf(tls *TLS, s uintptr, fmt uintptr, va uintptr) (r int32) TEXT ·Yswscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -14571,6 +16822,8 @@ TEXT ·Yswscanf(SB),$40-36 // func Ysymlink(tls *TLS, existing uintptr, new1 uintptr) (r int32) TEXT ·Ysymlink(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ existing+8(FP), AX @@ -14584,6 +16837,8 @@ TEXT ·Ysymlink(SB),$32-28 // func Ysymlinkat(tls *TLS, existing uintptr, fd int32, new1 uintptr) (r int32) TEXT ·Ysymlinkat(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ existing+8(FP), AX @@ -14599,6 +16854,8 @@ TEXT ·Ysymlinkat(SB),$40-36 // func Ysync(tls *TLS) TEXT ·Ysync(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xsync(SB) @@ -14606,6 +16863,8 @@ TEXT ·Ysync(SB),$8-8 // func Ysync_file_range(tls *TLS, fd int32, pos Toff_t, len1 Toff_t, flags uint32) (r int32) TEXT ·Ysync_file_range(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14623,6 +16882,8 @@ TEXT ·Ysync_file_range(SB),$48-44 // func Ysyncfs(tls *TLS, fd int32) (r int32) TEXT ·Ysyncfs(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14634,6 +16895,8 @@ TEXT ·Ysyncfs(SB),$24-20 // func Ysyscall(tls *TLS, n int64, va uintptr) (r int64) TEXT ·Ysyscall(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ n+8(FP), AX @@ -14647,6 +16910,8 @@ TEXT ·Ysyscall(SB),$32-32 // func Ysysconf(tls *TLS, name int32) (r int64) TEXT ·Ysysconf(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL name+8(FP), AX @@ -14658,6 +16923,8 @@ TEXT ·Ysysconf(SB),$24-24 // func Ysysctlbyname(t *TLS, name, oldp, oldlenp, newp uintptr, newlen Tsize_t) int32 TEXT ·Ysysctlbyname(SB),$56-52 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -14677,6 +16944,8 @@ TEXT ·Ysysctlbyname(SB),$56-52 // func Ysysinfo(tls *TLS, info uintptr) (r int32) TEXT ·Ysysinfo(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ info+8(FP), AX @@ -14688,6 +16957,8 @@ TEXT ·Ysysinfo(SB),$24-20 // func Ysyslog(tls *TLS, priority int32, message uintptr, va uintptr) TEXT ·Ysyslog(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL priority+8(FP), AX @@ -14701,6 +16972,8 @@ TEXT ·Ysyslog(SB),$32-32 // func Ysystem(t *TLS, command uintptr) int32 TEXT ·Ysystem(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ command+8(FP), AX @@ -14712,6 +16985,8 @@ TEXT ·Ysystem(SB),$24-20 // func Ytan(tls *TLS, x3 float64) (r float64) TEXT ·Ytan(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -14723,6 +16998,8 @@ TEXT ·Ytan(SB),$24-24 // func Ytanf(tls *TLS, x3 float32) (r float32) TEXT ·Ytanf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -14734,6 +17011,8 @@ TEXT ·Ytanf(SB),$24-20 // func Ytanh(tls *TLS, x3 float64) (r float64) TEXT ·Ytanh(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -14745,6 +17024,8 @@ TEXT ·Ytanh(SB),$24-24 // func Ytanhf(tls *TLS, x3 float32) (r float32) TEXT ·Ytanhf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -14756,6 +17037,8 @@ TEXT ·Ytanhf(SB),$24-20 // func Ytanhl(tls *TLS, x float64) (r float64) TEXT ·Ytanhl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -14767,6 +17050,8 @@ TEXT ·Ytanhl(SB),$24-24 // func Ytanl(tls *TLS, x float64) (r float64) TEXT ·Ytanl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -14778,6 +17063,8 @@ TEXT ·Ytanl(SB),$24-24 // func Ytcdrain(tls *TLS, fd int32) (r int32) TEXT ·Ytcdrain(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14789,6 +17076,8 @@ TEXT ·Ytcdrain(SB),$24-20 // func Ytcflow(tls *TLS, fd int32, action int32) (r int32) TEXT ·Ytcflow(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14802,6 +17091,8 @@ TEXT ·Ytcflow(SB),$24-20 // func Ytcflush(tls *TLS, fd int32, queue int32) (r int32) TEXT ·Ytcflush(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14815,6 +17106,8 @@ TEXT ·Ytcflush(SB),$24-20 // func Ytcgetattr(tls *TLS, fd int32, tio uintptr) (r int32) TEXT ·Ytcgetattr(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14828,6 +17121,8 @@ TEXT ·Ytcgetattr(SB),$32-28 // func Ytcgetpgrp(tls *TLS, fd int32) (r Tpid_t) TEXT ·Ytcgetpgrp(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14839,6 +17134,8 @@ TEXT ·Ytcgetpgrp(SB),$24-20 // func Ytcgetsid(tls *TLS, fd int32) (r Tpid_t) TEXT ·Ytcgetsid(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14850,6 +17147,8 @@ TEXT ·Ytcgetsid(SB),$24-20 // func Ytcgetwinsize(tls *TLS, fd int32, wsz uintptr) (r int32) TEXT ·Ytcgetwinsize(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14863,6 +17162,8 @@ TEXT ·Ytcgetwinsize(SB),$32-28 // func Ytcsendbreak(tls *TLS, fd int32, dur int32) (r int32) TEXT ·Ytcsendbreak(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14876,6 +17177,8 @@ TEXT ·Ytcsendbreak(SB),$24-20 // func Ytcsetattr(tls *TLS, fd int32, act int32, tio uintptr) (r int32) TEXT ·Ytcsetattr(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14891,6 +17194,8 @@ TEXT ·Ytcsetattr(SB),$32-28 // func Ytcsetpgrp(tls *TLS, fd int32, pgrp Tpid_t) (r int32) TEXT ·Ytcsetpgrp(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14904,6 +17209,8 @@ TEXT ·Ytcsetpgrp(SB),$24-20 // func Ytcsetwinsize(tls *TLS, fd int32, wsz uintptr) (r int32) TEXT ·Ytcsetwinsize(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -14917,6 +17224,8 @@ TEXT ·Ytcsetwinsize(SB),$32-28 // func Ytdelete(tls *TLS, key uintptr, rootp uintptr, cmp uintptr) (r uintptr) TEXT ·Ytdelete(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -14932,6 +17241,8 @@ TEXT ·Ytdelete(SB),$40-40 // func Ytdestroy(tls *TLS, root uintptr, freekey uintptr) TEXT ·Ytdestroy(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ root+8(FP), AX @@ -14943,6 +17254,8 @@ TEXT ·Ytdestroy(SB),$24-24 // func Ytee(tls *TLS, src int32, dest int32, len1 Tsize_t, flags uint32) (r Tssize_t) TEXT ·Ytee(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL src+8(FP), AX @@ -14960,6 +17273,8 @@ TEXT ·Ytee(SB),$40-40 // func Ytelldir(tls *TLS, dir uintptr) (r int64) TEXT ·Ytelldir(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -14971,6 +17286,8 @@ TEXT ·Ytelldir(SB),$24-24 // func Ytempnam(tls *TLS, dir uintptr, pfx uintptr) (r1 uintptr) TEXT ·Ytempnam(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dir+8(FP), AX @@ -14984,6 +17301,8 @@ TEXT ·Ytempnam(SB),$32-32 // func Ytextdomain(tls *TLS, domainname uintptr) (r uintptr) TEXT ·Ytextdomain(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ domainname+8(FP), AX @@ -14995,6 +17314,8 @@ TEXT ·Ytextdomain(SB),$24-24 // func Ytfind(tls *TLS, key uintptr, rootp uintptr, cmp uintptr) (r uintptr) TEXT ·Ytfind(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -15010,6 +17331,8 @@ TEXT ·Ytfind(SB),$40-40 // func Ytgamma(tls *TLS, x3 float64) (r1 float64) TEXT ·Ytgamma(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -15021,6 +17344,8 @@ TEXT ·Ytgamma(SB),$24-24 // func Ytgammaf(tls *TLS, x float32) (r float32) TEXT ·Ytgammaf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -15032,6 +17357,8 @@ TEXT ·Ytgammaf(SB),$24-20 // func Ytgammal(tls *TLS, x float64) (r float64) TEXT ·Ytgammal(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -15043,6 +17370,8 @@ TEXT ·Ytgammal(SB),$24-24 // func Ytime(tls *TLS, t uintptr) (r Ttime_t) TEXT ·Ytime(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -15054,6 +17383,8 @@ TEXT ·Ytime(SB),$24-24 // func Ytimegm(tls *TLS, tm uintptr) (r Ttime_t) TEXT ·Ytimegm(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tm+8(FP), AX @@ -15065,6 +17396,8 @@ TEXT ·Ytimegm(SB),$24-24 // func Ytimer_delete(tls *TLS, t Ttimer_t) (r int32) TEXT ·Ytimer_delete(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -15076,6 +17409,8 @@ TEXT ·Ytimer_delete(SB),$24-20 // func Ytimer_getoverrun(tls *TLS, t Ttimer_t) (r int32) TEXT ·Ytimer_getoverrun(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -15087,6 +17422,8 @@ TEXT ·Ytimer_getoverrun(SB),$24-20 // func Ytimer_gettime(tls *TLS, t Ttimer_t, val uintptr) (r int32) TEXT ·Ytimer_gettime(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -15100,6 +17437,8 @@ TEXT ·Ytimer_gettime(SB),$32-28 // func Ytimer_settime(tls *TLS, t Ttimer_t, flags int32, val uintptr, old uintptr) (r int32) TEXT ·Ytimer_settime(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ t+8(FP), AX @@ -15117,6 +17456,8 @@ TEXT ·Ytimer_settime(SB),$48-44 // func Ytimerfd_create(tls *TLS, clockid int32, flags int32) (r int32) TEXT ·Ytimerfd_create(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL clockid+8(FP), AX @@ -15130,6 +17471,8 @@ TEXT ·Ytimerfd_create(SB),$24-20 // func Ytimerfd_gettime(tls *TLS, fd int32, cur uintptr) (r int32) TEXT ·Ytimerfd_gettime(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15143,6 +17486,8 @@ TEXT ·Ytimerfd_gettime(SB),$32-28 // func Ytimerfd_settime(tls *TLS, fd int32, flags int32, new1 uintptr, old uintptr) (r int32) TEXT ·Ytimerfd_settime(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15160,6 +17505,8 @@ TEXT ·Ytimerfd_settime(SB),$40-36 // func Ytimes(tls *TLS, tms uintptr) (r Tclock_t) TEXT ·Ytimes(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ tms+8(FP), AX @@ -15171,6 +17518,8 @@ TEXT ·Ytimes(SB),$24-24 // func Ytimespec_get(tls *TLS, ts uintptr, base int32) (r int32) TEXT ·Ytimespec_get(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ ts+8(FP), AX @@ -15184,6 +17533,8 @@ TEXT ·Ytimespec_get(SB),$32-28 // func Ytmpfile(tls *TLS) (r uintptr) TEXT ·Ytmpfile(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xtmpfile(SB) @@ -15193,6 +17544,8 @@ TEXT ·Ytmpfile(SB),$16-16 // func Ytmpnam(tls *TLS, buf uintptr) (r1 uintptr) TEXT ·Ytmpnam(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ buf+8(FP), AX @@ -15204,6 +17557,8 @@ TEXT ·Ytmpnam(SB),$24-24 // func Ytoascii(tls *TLS, c int32) (r int32) TEXT ·Ytoascii(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15215,6 +17570,8 @@ TEXT ·Ytoascii(SB),$24-20 // func Ytolower(tls *TLS, c int32) (r int32) TEXT ·Ytolower(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15226,6 +17583,8 @@ TEXT ·Ytolower(SB),$24-20 // func Ytolower_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Ytolower_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15239,6 +17598,8 @@ TEXT ·Ytolower_l(SB),$32-28 // func Ytoupper(tls *TLS, c int32) (r int32) TEXT ·Ytoupper(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15250,6 +17611,8 @@ TEXT ·Ytoupper(SB),$24-20 // func Ytoupper_l(tls *TLS, c int32, l Tlocale_t) (r int32) TEXT ·Ytoupper_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15263,6 +17626,8 @@ TEXT ·Ytoupper_l(SB),$32-28 // func Ytowctrans(tls *TLS, wc Twint_t, trans Twctrans_t) (r Twint_t) TEXT ·Ytowctrans(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -15276,6 +17641,8 @@ TEXT ·Ytowctrans(SB),$32-28 // func Ytowctrans_l(tls *TLS, c Twint_t, t Twctrans_t, l Tlocale_t) (r Twint_t) TEXT ·Ytowctrans_l(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15291,6 +17658,8 @@ TEXT ·Ytowctrans_l(SB),$40-36 // func Ytowlower(tls *TLS, wc Twint_t) (r Twint_t) TEXT ·Ytowlower(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -15302,6 +17671,8 @@ TEXT ·Ytowlower(SB),$24-20 // func Ytowlower_l(tls *TLS, c Twint_t, l Tlocale_t) (r Twint_t) TEXT ·Ytowlower_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15315,6 +17686,8 @@ TEXT ·Ytowlower_l(SB),$32-28 // func Ytowupper(tls *TLS, wc Twint_t) (r Twint_t) TEXT ·Ytowupper(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -15326,6 +17699,8 @@ TEXT ·Ytowupper(SB),$24-20 // func Ytowupper_l(tls *TLS, c Twint_t, l Tlocale_t) (r Twint_t) TEXT ·Ytowupper_l(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15339,6 +17714,8 @@ TEXT ·Ytowupper_l(SB),$32-28 // func Ytrunc(tls *TLS, x3 float64) (r float64) TEXT ·Ytrunc(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x3+8(FP), AX @@ -15350,6 +17727,8 @@ TEXT ·Ytrunc(SB),$24-24 // func Ytruncate(tls *TLS, path uintptr, length Toff_t) (r int32) TEXT ·Ytruncate(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -15363,6 +17742,8 @@ TEXT ·Ytruncate(SB),$32-28 // func Ytruncf(tls *TLS, x3 float32) (r float32) TEXT ·Ytruncf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x3+8(FP), AX @@ -15374,6 +17755,8 @@ TEXT ·Ytruncf(SB),$24-20 // func Ytruncl(tls *TLS, x float64) (r float64) TEXT ·Ytruncl(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -15385,6 +17768,8 @@ TEXT ·Ytruncl(SB),$24-24 // func Ytsearch(tls *TLS, key uintptr, rootp uintptr, cmp uintptr) (r1 uintptr) TEXT ·Ytsearch(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ key+8(FP), AX @@ -15400,6 +17785,8 @@ TEXT ·Ytsearch(SB),$40-40 // func Yttyname(tls *TLS, fd int32) (r uintptr) TEXT ·Yttyname(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15411,6 +17798,8 @@ TEXT ·Yttyname(SB),$24-24 // func Yttyname_r(tls *TLS, fd int32, name uintptr, size Tsize_t) (r int32) TEXT ·Yttyname_r(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15426,6 +17815,8 @@ TEXT ·Yttyname_r(SB),$40-36 // func Ytwalk(tls *TLS, root uintptr, action uintptr) TEXT ·Ytwalk(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ root+8(FP), AX @@ -15437,6 +17828,8 @@ TEXT ·Ytwalk(SB),$24-24 // func Ytzset(tls *TLS) TEXT ·Ytzset(SB),$8-8 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xtzset(SB) @@ -15444,6 +17837,8 @@ TEXT ·Ytzset(SB),$8-8 // func Yualarm(tls *TLS, value uint32, interval uint32) (r uint32) TEXT ·Yualarm(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL value+8(FP), AX @@ -15457,6 +17852,8 @@ TEXT ·Yualarm(SB),$24-20 // func Yulckpwdf(tls *TLS) (r int32) TEXT ·Yulckpwdf(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xulckpwdf(SB) @@ -15466,6 +17863,8 @@ TEXT ·Yulckpwdf(SB),$16-12 // func Yulimit(tls *TLS, cmd int32, va uintptr) (r int64) TEXT ·Yulimit(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL cmd+8(FP), AX @@ -15479,6 +17878,8 @@ TEXT ·Yulimit(SB),$32-32 // func Yumask(tls *TLS, mode Tmode_t) (r Tmode_t) TEXT ·Yumask(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL mode+8(FP), AX @@ -15490,6 +17891,8 @@ TEXT ·Yumask(SB),$24-20 // func Yumount(tls *TLS, special uintptr) (r int32) TEXT ·Yumount(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ special+8(FP), AX @@ -15501,6 +17904,8 @@ TEXT ·Yumount(SB),$24-20 // func Yumount2(tls *TLS, special uintptr, flags int32) (r int32) TEXT ·Yumount2(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ special+8(FP), AX @@ -15514,6 +17919,8 @@ TEXT ·Yumount2(SB),$32-28 // func Yuname(tls *TLS, uts uintptr) (r int32) TEXT ·Yuname(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ uts+8(FP), AX @@ -15525,6 +17932,8 @@ TEXT ·Yuname(SB),$24-20 // func Yungetc(tls *TLS, c int32, f uintptr) (r int32) TEXT ·Yungetc(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15538,6 +17947,8 @@ TEXT ·Yungetc(SB),$32-28 // func Yungetwc(tls *TLS, c Twint_t, f uintptr) (r Twint_t) TEXT ·Yungetwc(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -15551,6 +17962,8 @@ TEXT ·Yungetwc(SB),$32-28 // func Yunlink(tls *TLS, path uintptr) (r int32) TEXT ·Yunlink(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -15562,6 +17975,8 @@ TEXT ·Yunlink(SB),$24-20 // func Yunlinkat(tls *TLS, fd int32, path uintptr, flag int32) (r int32) TEXT ·Yunlinkat(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15577,6 +17992,8 @@ TEXT ·Yunlinkat(SB),$40-36 // func Yunlockpt(tls *TLS, fd int32) (r int32) TEXT ·Yunlockpt(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15588,6 +18005,8 @@ TEXT ·Yunlockpt(SB),$24-20 // func Yunsetenv(tls *TLS, name uintptr) (r int32) TEXT ·Yunsetenv(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ name+8(FP), AX @@ -15599,6 +18018,8 @@ TEXT ·Yunsetenv(SB),$24-20 // func Yunshare(tls *TLS, flags int32) (r int32) TEXT ·Yunshare(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL flags+8(FP), AX @@ -15610,6 +18031,8 @@ TEXT ·Yunshare(SB),$24-20 // func Yupdwtmp(tls *TLS, f uintptr, u uintptr) TEXT ·Yupdwtmp(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -15621,6 +18044,8 @@ TEXT ·Yupdwtmp(SB),$24-24 // func Yupdwtmpx(tls *TLS, f uintptr, u uintptr) TEXT ·Yupdwtmpx(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -15632,6 +18057,8 @@ TEXT ·Yupdwtmpx(SB),$24-24 // func Yuselocale(tls *TLS, new1 Tlocale_t) (r Tlocale_t) TEXT ·Yuselocale(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ new1+8(FP), AX @@ -15643,6 +18070,8 @@ TEXT ·Yuselocale(SB),$24-24 // func Yusleep(tls *TLS, useconds uint32) (r int32) TEXT ·Yusleep(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL useconds+8(FP), AX @@ -15654,6 +18083,8 @@ TEXT ·Yusleep(SB),$24-20 // func Yutime(tls *TLS, path uintptr, times uintptr) (r int32) TEXT ·Yutime(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -15667,6 +18098,8 @@ TEXT ·Yutime(SB),$32-28 // func Yutimensat(tls *TLS, fd int32, path uintptr, times uintptr, flags int32) (r1 int32) TEXT ·Yutimensat(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15684,6 +18117,8 @@ TEXT ·Yutimensat(SB),$48-44 // func Yutimes(tls *TLS, path uintptr, times uintptr) (r int32) TEXT ·Yutimes(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ path+8(FP), AX @@ -15697,6 +18132,8 @@ TEXT ·Yutimes(SB),$32-28 // func Yuuid_copy(t *TLS, dst, src uintptr) TEXT ·Yuuid_copy(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ dst+8(FP), AX @@ -15708,6 +18145,8 @@ TEXT ·Yuuid_copy(SB),$24-24 // func Yuuid_generate_random(t *TLS, out uintptr) TEXT ·Yuuid_generate_random(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ out+8(FP), AX @@ -15717,6 +18156,8 @@ TEXT ·Yuuid_generate_random(SB),$16-16 // func Yuuid_parse(t *TLS, in uintptr, uu uintptr) int32 TEXT ·Yuuid_parse(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ in+8(FP), AX @@ -15730,6 +18171,8 @@ TEXT ·Yuuid_parse(SB),$32-28 // func Yuuid_unparse(t *TLS, uu, out uintptr) TEXT ·Yuuid_unparse(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ t+0(FP), AX MOVQ AX, 0(SP) MOVQ uu+8(FP), AX @@ -15741,6 +18184,8 @@ TEXT ·Yuuid_unparse(SB),$24-24 // func Yvasprintf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvasprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -15756,6 +18201,8 @@ TEXT ·Yvasprintf(SB),$40-36 // func Yvdprintf(tls *TLS, fd int32, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvdprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15771,6 +18218,8 @@ TEXT ·Yvdprintf(SB),$40-36 // func Yverr(tls *TLS, status int32, fmt uintptr, ap Tva_list) TEXT ·Yverr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL status+8(FP), AX @@ -15784,6 +18233,8 @@ TEXT ·Yverr(SB),$32-32 // func Yverrx(tls *TLS, status int32, fmt uintptr, ap Tva_list) TEXT ·Yverrx(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL status+8(FP), AX @@ -15797,6 +18248,8 @@ TEXT ·Yverrx(SB),$32-32 // func Yversionsort(tls *TLS, a uintptr, b uintptr) (r int32) TEXT ·Yversionsort(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ a+8(FP), AX @@ -15810,6 +18263,8 @@ TEXT ·Yversionsort(SB),$32-28 // func Yvfork(tls *TLS) (r Tpid_t) TEXT ·Yvfork(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xvfork(SB) @@ -15819,6 +18274,8 @@ TEXT ·Yvfork(SB),$16-12 // func Yvfprintf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvfprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -15834,6 +18291,8 @@ TEXT ·Yvfprintf(SB),$40-36 // func Yvfscanf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvfscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -15849,6 +18308,8 @@ TEXT ·Yvfscanf(SB),$40-36 // func Yvfwprintf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvfwprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -15864,6 +18325,8 @@ TEXT ·Yvfwprintf(SB),$40-36 // func Yvfwscanf(tls *TLS, f uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvfwscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ f+8(FP), AX @@ -15879,6 +18342,8 @@ TEXT ·Yvfwscanf(SB),$40-36 // func Yvhangup(tls *TLS) (r int32) TEXT ·Yvhangup(SB),$16-12 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) CALL ·Xvhangup(SB) @@ -15888,6 +18353,8 @@ TEXT ·Yvhangup(SB),$16-12 // func Yvmsplice(tls *TLS, fd int32, iov uintptr, cnt Tsize_t, flags uint32) (r Tssize_t) TEXT ·Yvmsplice(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -15905,6 +18372,8 @@ TEXT ·Yvmsplice(SB),$48-48 // func Yvprintf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvprintf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -15918,6 +18387,8 @@ TEXT ·Yvprintf(SB),$32-28 // func Yvscanf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvscanf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -15931,6 +18402,8 @@ TEXT ·Yvscanf(SB),$32-28 // func Yvsnprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvsnprintf(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -15948,6 +18421,8 @@ TEXT ·Yvsnprintf(SB),$48-44 // func Yvsprintf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvsprintf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -15963,6 +18438,8 @@ TEXT ·Yvsprintf(SB),$40-36 // func Yvsscanf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvsscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -15978,6 +18455,8 @@ TEXT ·Yvsscanf(SB),$40-36 // func Yvswprintf(tls *TLS, s uintptr, n Tsize_t, fmt uintptr, ap Tva_list) (r1 int32) TEXT ·Yvswprintf(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -15995,6 +18474,8 @@ TEXT ·Yvswprintf(SB),$48-44 // func Yvswscanf(tls *TLS, s uintptr, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvswscanf(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16010,6 +18491,8 @@ TEXT ·Yvswscanf(SB),$40-36 // func Yvwarn(tls *TLS, fmt uintptr, ap Tva_list) TEXT ·Yvwarn(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16021,6 +18504,8 @@ TEXT ·Yvwarn(SB),$24-24 // func Yvwarnx(tls *TLS, fmt uintptr, ap Tva_list) TEXT ·Yvwarnx(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16032,6 +18517,8 @@ TEXT ·Yvwarnx(SB),$24-24 // func Yvwprintf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvwprintf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16045,6 +18532,8 @@ TEXT ·Yvwprintf(SB),$32-28 // func Yvwscanf(tls *TLS, fmt uintptr, ap Tva_list) (r int32) TEXT ·Yvwscanf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16058,6 +18547,8 @@ TEXT ·Yvwscanf(SB),$32-28 // func Ywait(tls *TLS, status uintptr) (r Tpid_t) TEXT ·Ywait(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ status+8(FP), AX @@ -16069,6 +18560,8 @@ TEXT ·Ywait(SB),$24-20 // func Ywait3(tls *TLS, status uintptr, options int32, usage uintptr) (r Tpid_t) TEXT ·Ywait3(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ status+8(FP), AX @@ -16084,6 +18577,8 @@ TEXT ·Ywait3(SB),$40-36 // func Ywait4(tls *TLS, pid Tpid_t, status uintptr, options int32, ru uintptr) (r1 Tpid_t) TEXT ·Ywait4(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -16101,6 +18596,8 @@ TEXT ·Ywait4(SB),$48-44 // func Ywaitid(tls *TLS, type1 Tidtype_t, id Tid_t, info uintptr, options int32) (r int32) TEXT ·Ywaitid(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL type1+8(FP), AX @@ -16118,6 +18615,8 @@ TEXT ·Ywaitid(SB),$40-36 // func Ywaitpid(tls *TLS, pid Tpid_t, status uintptr, options int32) (r Tpid_t) TEXT ·Ywaitpid(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL pid+8(FP), AX @@ -16133,6 +18632,8 @@ TEXT ·Ywaitpid(SB),$40-36 // func Ywarn(tls *TLS, fmt uintptr, va uintptr) TEXT ·Ywarn(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16144,6 +18645,8 @@ TEXT ·Ywarn(SB),$24-24 // func Ywarnx(tls *TLS, fmt uintptr, va uintptr) TEXT ·Ywarnx(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16155,6 +18658,8 @@ TEXT ·Ywarnx(SB),$24-24 // func Ywcpcpy(tls *TLS, d uintptr, s uintptr) (r uintptr) TEXT ·Ywcpcpy(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16168,6 +18673,8 @@ TEXT ·Ywcpcpy(SB),$32-32 // func Ywcpncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ywcpncpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16183,6 +18690,8 @@ TEXT ·Ywcpncpy(SB),$40-40 // func Ywcrtomb(tls *TLS, s uintptr, wc Twchar_t, st uintptr) (r Tsize_t) TEXT ·Ywcrtomb(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16198,6 +18707,8 @@ TEXT ·Ywcrtomb(SB),$40-40 // func Ywcscasecmp(tls *TLS, l uintptr, r uintptr) (r1 int32) TEXT ·Ywcscasecmp(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16211,6 +18722,8 @@ TEXT ·Ywcscasecmp(SB),$32-28 // func Ywcscasecmp_l(tls *TLS, l uintptr, r uintptr, locale Tlocale_t) (r1 int32) TEXT ·Ywcscasecmp_l(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16226,6 +18739,8 @@ TEXT ·Ywcscasecmp_l(SB),$40-36 // func Ywcscat(tls *TLS, dest uintptr, src uintptr) (r uintptr) TEXT ·Ywcscat(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -16239,6 +18754,8 @@ TEXT ·Ywcscat(SB),$32-32 // func Ywcschr(tls *TLS, s uintptr, c Twchar_t) (r uintptr) TEXT ·Ywcschr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16252,6 +18769,8 @@ TEXT ·Ywcschr(SB),$32-32 // func Ywcscmp(tls *TLS, l uintptr, r uintptr) (r1 int32) TEXT ·Ywcscmp(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16265,6 +18784,8 @@ TEXT ·Ywcscmp(SB),$32-28 // func Ywcscoll(tls *TLS, l uintptr, r uintptr) (r1 int32) TEXT ·Ywcscoll(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16278,6 +18799,8 @@ TEXT ·Ywcscoll(SB),$32-28 // func Ywcscoll_l(tls *TLS, l uintptr, r uintptr, locale Tlocale_t) (r1 int32) TEXT ·Ywcscoll_l(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16293,6 +18816,8 @@ TEXT ·Ywcscoll_l(SB),$40-36 // func Ywcscpy(tls *TLS, d uintptr, s uintptr) (r uintptr) TEXT ·Ywcscpy(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16306,6 +18831,8 @@ TEXT ·Ywcscpy(SB),$32-32 // func Ywcscspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) TEXT ·Ywcscspn(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16319,6 +18846,8 @@ TEXT ·Ywcscspn(SB),$32-32 // func Ywcsdup(tls *TLS, s uintptr) (r uintptr) TEXT ·Ywcsdup(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16330,6 +18859,8 @@ TEXT ·Ywcsdup(SB),$24-24 // func Ywcsftime(tls *TLS, wcs uintptr, n Tsize_t, f uintptr, tm uintptr) (r Tsize_t) TEXT ·Ywcsftime(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ wcs+8(FP), AX @@ -16347,6 +18878,8 @@ TEXT ·Ywcsftime(SB),$48-48 // func Ywcsftime_l(tls *TLS, s uintptr, n Tsize_t, f uintptr, tm uintptr, loc Tlocale_t) (r Tsize_t) TEXT ·Ywcsftime_l(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16366,6 +18899,8 @@ TEXT ·Ywcsftime_l(SB),$56-56 // func Ywcslen(tls *TLS, s uintptr) (r Tsize_t) TEXT ·Ywcslen(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16377,6 +18912,8 @@ TEXT ·Ywcslen(SB),$24-24 // func Ywcsncasecmp(tls *TLS, l uintptr, r uintptr, n Tsize_t) (r1 int32) TEXT ·Ywcsncasecmp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16392,6 +18929,8 @@ TEXT ·Ywcsncasecmp(SB),$40-36 // func Ywcsncasecmp_l(tls *TLS, l uintptr, r uintptr, n Tsize_t, locale Tlocale_t) (r1 int32) TEXT ·Ywcsncasecmp_l(SB),$48-44 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16409,6 +18948,8 @@ TEXT ·Ywcsncasecmp_l(SB),$48-44 // func Ywcsncat(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ywcsncat(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16424,6 +18965,8 @@ TEXT ·Ywcsncat(SB),$40-40 // func Ywcsncmp(tls *TLS, l uintptr, r uintptr, n Tsize_t) (r1 int32) TEXT ·Ywcsncmp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16439,6 +18982,8 @@ TEXT ·Ywcsncmp(SB),$40-36 // func Ywcsncpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ywcsncpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16454,6 +18999,8 @@ TEXT ·Ywcsncpy(SB),$40-40 // func Ywcsnlen(tls *TLS, s uintptr, n Tsize_t) (r Tsize_t) TEXT ·Ywcsnlen(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16467,6 +19014,8 @@ TEXT ·Ywcsnlen(SB),$32-32 // func Ywcsnrtombs(tls *TLS, dst uintptr, wcs uintptr, wn Tsize_t, n Tsize_t, st uintptr) (r Tsize_t) TEXT ·Ywcsnrtombs(SB),$56-56 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dst+8(FP), AX @@ -16486,6 +19035,8 @@ TEXT ·Ywcsnrtombs(SB),$56-56 // func Ywcspbrk(tls *TLS, s uintptr, b uintptr) (r uintptr) TEXT ·Ywcspbrk(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16499,6 +19050,8 @@ TEXT ·Ywcspbrk(SB),$32-32 // func Ywcsrchr(tls *TLS, s uintptr, c Twchar_t) (r uintptr) TEXT ·Ywcsrchr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16512,6 +19065,8 @@ TEXT ·Ywcsrchr(SB),$32-32 // func Ywcsrtombs(tls *TLS, s uintptr, ws uintptr, n Tsize_t, st uintptr) (r Tsize_t) TEXT ·Ywcsrtombs(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16529,6 +19084,8 @@ TEXT ·Ywcsrtombs(SB),$48-48 // func Ywcsspn(tls *TLS, s uintptr, c uintptr) (r Tsize_t) TEXT ·Ywcsspn(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16542,6 +19099,8 @@ TEXT ·Ywcsspn(SB),$32-32 // func Ywcsstr(tls *TLS, h uintptr, n uintptr) (r uintptr) TEXT ·Ywcsstr(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ h+8(FP), AX @@ -16555,6 +19114,8 @@ TEXT ·Ywcsstr(SB),$32-32 // func Ywcstod(tls *TLS, s uintptr, p uintptr) (r float64) TEXT ·Ywcstod(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16568,6 +19129,8 @@ TEXT ·Ywcstod(SB),$32-32 // func Ywcstof(tls *TLS, s uintptr, p uintptr) (r float32) TEXT ·Ywcstof(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16581,6 +19144,8 @@ TEXT ·Ywcstof(SB),$32-28 // func Ywcstoimax(tls *TLS, s uintptr, p uintptr, base int32) (r Tintmax_t) TEXT ·Ywcstoimax(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16596,6 +19161,8 @@ TEXT ·Ywcstoimax(SB),$40-40 // func Ywcstok(tls *TLS, s uintptr, sep uintptr, p uintptr) (r uintptr) TEXT ·Ywcstok(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16611,6 +19178,8 @@ TEXT ·Ywcstok(SB),$40-40 // func Ywcstol(tls *TLS, s uintptr, p uintptr, base int32) (r int64) TEXT ·Ywcstol(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16626,6 +19195,8 @@ TEXT ·Ywcstol(SB),$40-40 // func Ywcstold(tls *TLS, s uintptr, p uintptr) (r float64) TEXT ·Ywcstold(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16639,6 +19210,8 @@ TEXT ·Ywcstold(SB),$32-32 // func Ywcstoll(tls *TLS, s uintptr, p uintptr, base int32) (r int64) TEXT ·Ywcstoll(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16654,6 +19227,8 @@ TEXT ·Ywcstoll(SB),$40-40 // func Ywcstombs(tls *TLS, s uintptr, ws uintptr, n Tsize_t) (r Tsize_t) TEXT ·Ywcstombs(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16669,6 +19244,8 @@ TEXT ·Ywcstombs(SB),$40-40 // func Ywcstoul(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) TEXT ·Ywcstoul(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16684,6 +19261,8 @@ TEXT ·Ywcstoul(SB),$40-40 // func Ywcstoull(tls *TLS, s uintptr, p uintptr, base int32) (r uint64) TEXT ·Ywcstoull(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16699,6 +19278,8 @@ TEXT ·Ywcstoull(SB),$40-40 // func Ywcstoumax(tls *TLS, s uintptr, p uintptr, base int32) (r Tuintmax_t) TEXT ·Ywcstoumax(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16714,6 +19295,8 @@ TEXT ·Ywcstoumax(SB),$40-40 // func Ywcswcs(tls *TLS, haystack uintptr, needle uintptr) (r uintptr) TEXT ·Ywcswcs(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ haystack+8(FP), AX @@ -16727,6 +19310,8 @@ TEXT ·Ywcswcs(SB),$32-32 // func Ywcswidth(tls *TLS, wcs uintptr, n Tsize_t) (r int32) TEXT ·Ywcswidth(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ wcs+8(FP), AX @@ -16740,6 +19325,8 @@ TEXT ·Ywcswidth(SB),$32-28 // func Ywcsxfrm(tls *TLS, dest uintptr, src uintptr, n Tsize_t) (r Tsize_t) TEXT ·Ywcsxfrm(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -16755,6 +19342,8 @@ TEXT ·Ywcsxfrm(SB),$40-40 // func Ywcsxfrm_l(tls *TLS, dest uintptr, src uintptr, n Tsize_t, loc Tlocale_t) (r Tsize_t) TEXT ·Ywcsxfrm_l(SB),$48-48 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ dest+8(FP), AX @@ -16772,6 +19361,8 @@ TEXT ·Ywcsxfrm_l(SB),$48-48 // func Ywctob(tls *TLS, c Twint_t) (r int32) TEXT ·Ywctob(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL c+8(FP), AX @@ -16783,6 +19374,8 @@ TEXT ·Ywctob(SB),$24-20 // func Ywctomb(tls *TLS, s uintptr, wc Twchar_t) (r int32) TEXT ·Ywctomb(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16796,6 +19389,8 @@ TEXT ·Ywctomb(SB),$32-28 // func Ywctrans(tls *TLS, class uintptr) (r Twctrans_t) TEXT ·Ywctrans(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ class+8(FP), AX @@ -16807,6 +19402,8 @@ TEXT ·Ywctrans(SB),$24-24 // func Ywctrans_l(tls *TLS, s uintptr, l Tlocale_t) (r Twctrans_t) TEXT ·Ywctrans_l(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16820,6 +19417,8 @@ TEXT ·Ywctrans_l(SB),$32-32 // func Ywctype(tls *TLS, s uintptr) (r Twctype_t) TEXT ·Ywctype(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16831,6 +19430,8 @@ TEXT ·Ywctype(SB),$24-24 // func Ywctype_l(tls *TLS, s uintptr, l Tlocale_t) (r Twctype_t) TEXT ·Ywctype_l(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16844,6 +19445,8 @@ TEXT ·Ywctype_l(SB),$32-32 // func Ywcwidth(tls *TLS, wc Twchar_t) (r int32) TEXT ·Ywcwidth(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL wc+8(FP), AX @@ -16855,6 +19458,8 @@ TEXT ·Ywcwidth(SB),$24-20 // func Ywmemchr(tls *TLS, s uintptr, c Twchar_t, n Tsize_t) (r uintptr) TEXT ·Ywmemchr(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ s+8(FP), AX @@ -16870,6 +19475,8 @@ TEXT ·Ywmemchr(SB),$40-40 // func Ywmemcmp(tls *TLS, l uintptr, r uintptr, n Tsize_t) (r1 int32) TEXT ·Ywmemcmp(SB),$40-36 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ l+8(FP), AX @@ -16885,6 +19492,8 @@ TEXT ·Ywmemcmp(SB),$40-36 // func Ywmemcpy(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ywmemcpy(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16900,6 +19509,8 @@ TEXT ·Ywmemcpy(SB),$40-40 // func Ywmemmove(tls *TLS, d uintptr, s uintptr, n Tsize_t) (r uintptr) TEXT ·Ywmemmove(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16915,6 +19526,8 @@ TEXT ·Ywmemmove(SB),$40-40 // func Ywmemset(tls *TLS, d uintptr, c Twchar_t, n Tsize_t) (r uintptr) TEXT ·Ywmemset(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ d+8(FP), AX @@ -16930,6 +19543,8 @@ TEXT ·Ywmemset(SB),$40-40 // func Ywprintf(tls *TLS, fmt uintptr, va uintptr) (r int32) TEXT ·Ywprintf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16943,6 +19558,8 @@ TEXT ·Ywprintf(SB),$32-28 // func Ywrite(tls *TLS, fd int32, buf uintptr, count Tsize_t) (r Tssize_t) TEXT ·Ywrite(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -16958,6 +19575,8 @@ TEXT ·Ywrite(SB),$40-40 // func Ywritev(tls *TLS, fd int32, iov uintptr, count int32) (r Tssize_t) TEXT ·Ywritev(SB),$40-40 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL fd+8(FP), AX @@ -16973,6 +19592,8 @@ TEXT ·Ywritev(SB),$40-40 // func Ywscanf(tls *TLS, fmt uintptr, va uintptr) (r int32) TEXT ·Ywscanf(SB),$32-28 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ fmt+8(FP), AX @@ -16986,6 +19607,8 @@ TEXT ·Ywscanf(SB),$32-28 // func Yy0(tls *TLS, x float64) (r float64) TEXT ·Yy0(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -16997,6 +19620,8 @@ TEXT ·Yy0(SB),$24-24 // func Yy0f(tls *TLS, x float32) (r float32) TEXT ·Yy0f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -17008,6 +19633,8 @@ TEXT ·Yy0f(SB),$24-20 // func Yy1(tls *TLS, x float64) (r float64) TEXT ·Yy1(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVQ x+8(FP), AX @@ -17019,6 +19646,8 @@ TEXT ·Yy1(SB),$24-24 // func Yy1f(tls *TLS, x float32) (r float32) TEXT ·Yy1f(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL x+8(FP), AX @@ -17030,6 +19659,8 @@ TEXT ·Yy1f(SB),$24-20 // func Yyn(tls *TLS, n int32, x float64) (r float64) TEXT ·Yyn(SB),$32-32 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX @@ -17043,6 +19674,8 @@ TEXT ·Yyn(SB),$32-32 // func Yynf(tls *TLS, n int32, x float32) (r float32) TEXT ·Yynf(SB),$24-20 + GO_ARGS + NO_LOCAL_POINTERS MOVQ tls+0(FP), AX MOVQ AX, 0(SP) MOVL n+8(FP), AX diff --git a/vendor/modernc.org/libc/tls_linux_amd64.go b/vendor/modernc.org/libc/tls_linux_amd64.go index 4d0ce4ec76..aef3c54989 100644 --- a/vendor/modernc.org/libc/tls_linux_amd64.go +++ b/vendor/modernc.org/libc/tls_linux_amd64.go @@ -4,7 +4,9 @@ package libc // import "modernc.org/libc" +//go:noescape func TLSAlloc(p0 *TLS, p1 int) uintptr +//go:noescape func TLSFree(p0 *TLS, p1 int) func tlsAlloc(tls *TLS, n int) uintptr { diff --git a/vendor/modernc.org/libc/tls_linux_amd64.s b/vendor/modernc.org/libc/tls_linux_amd64.s index 490eafabab..9d55f5f04c 100644 --- a/vendor/modernc.org/libc/tls_linux_amd64.s +++ b/vendor/modernc.org/libc/tls_linux_amd64.s @@ -1,8 +1,9 @@ -// Code generated for linux/amd64 by 'genasm []', DO NOT EDIT. - +#include "funcdata.h" #include "textflag.h" TEXT ·TLSAlloc(SB),$24-24 + GO_ARGS + NO_LOCAL_POINTERS MOVQ p0+0(FP), AX MOVQ AX, 0(SP) MOVQ p1+8(FP), AX @@ -13,6 +14,8 @@ TEXT ·TLSAlloc(SB),$24-24 RET TEXT ·TLSFree(SB),$16-16 + GO_ARGS + NO_LOCAL_POINTERS MOVQ p0+0(FP), AX MOVQ AX, 0(SP) MOVQ p1+8(FP), AX diff --git a/vendor/modules.txt b/vendor/modules.txt index f1a74d2619..6ba8dbf55c 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -518,7 +518,7 @@ github.com/dgraph-io/ristretto/v2/z/simd ## explicit; go 1.13 github.com/dlclark/regexp2 github.com/dlclark/regexp2/syntax -# github.com/dop251/goja v0.0.0-20250531102226-cb187b08699c +# github.com/dop251/goja v0.0.0-20250624190929-4d26883d182a ## explicit; go 1.20 github.com/dop251/goja github.com/dop251/goja/ast @@ -728,7 +728,7 @@ github.com/klauspost/compress/s2 github.com/klauspost/compress/snappy github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.10 +# github.com/klauspost/cpuid/v2 v2.2.11 ## explicit; go 1.22 github.com/klauspost/cpuid/v2 # github.com/kr/pretty v0.3.1 @@ -1124,7 +1124,7 @@ go.etcd.io/bbolt/internal/freelist ## explicit; go 1.22.0 go.opentelemetry.io/auto/sdk go.opentelemetry.io/auto/sdk/internal/telemetry -# go.opentelemetry.io/otel v1.36.0 +# go.opentelemetry.io/otel v1.37.0 ## explicit; go 1.23.0 go.opentelemetry.io/otel go.opentelemetry.io/otel/attribute @@ -1135,11 +1135,12 @@ go.opentelemetry.io/otel/internal/baggage go.opentelemetry.io/otel/internal/global go.opentelemetry.io/otel/propagation go.opentelemetry.io/otel/semconv/v1.26.0 -# go.opentelemetry.io/otel/metric v1.36.0 +go.opentelemetry.io/otel/semconv/v1.34.0 +# go.opentelemetry.io/otel/metric v1.37.0 ## explicit; go 1.23.0 go.opentelemetry.io/otel/metric go.opentelemetry.io/otel/metric/embedded -# go.opentelemetry.io/otel/trace v1.36.0 +# go.opentelemetry.io/otel/trace v1.37.0 ## explicit; go 1.23.0 go.opentelemetry.io/otel/trace go.opentelemetry.io/otel/trace/embedded @@ -1332,7 +1333,7 @@ gopkg.in/yaml.v3 lukechampine.com/blake3 lukechampine.com/blake3/bao lukechampine.com/blake3/guts -# modernc.org/libc v1.66.0 +# modernc.org/libc v1.66.1 ## explicit; go 1.23.0 modernc.org/libc modernc.org/libc/errno